KEGG   Nostocales cyanobacterium HT-58-2: BZZ01_23130Help
Entry
BZZ01_23130       CDS       T04905                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ncn  Nostocales cyanobacterium HT-58-2
Brite
Enzymes [BR:ncn01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BZZ01_23130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ARV61125
UniProt: A0A1Y0RQE1
LinkDB All DBs
Position
complement(5615815..5616558)
Genome map
AA seq 247 aa AA seqDB search
MGIDRRHFLFLIGASAGAFALDACAGAQNAPSQNKPSPGKTGAIQLPPLPYPYQALEPHI
DAATMRFHHDKHHATYVKNLNAALDKHPELKSKTVEQLLRDLNSVPEDIRRTVRNNGGGH
ENHSMFWRIMKPKGGGEPTGAIASAIKQNFGNFAAFKKQFNEAGASRFGSGWVWLVRTKD
GKLAVTTTANQDSPFSEGNYPIMGNDVWEHAYYLKYQNRRADYLDAWWNVLNWDEINKRF
AQASKAA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgggtattgatcgtcgtcatttcttatttctcattggagctagtgcgggtgcttttgcc
ctagatgcttgtgctggggctcagaatgccccaagccaaaataaaccaagtccaggcaaa
acaggagctatccagctaccaccgttgccctatccctaccaggctcttgaaccacatatt
gatgctgcaacaatgcggtttcaccacgataaacaccatgcgacttatgtaaaaaactta
aatgcagcattagacaaacatccagaactgaaaagtaaaacagttgaacagctgctgcgt
gacctcaatagtgtaccagaagatattcgtagaacagtacgcaataacggtggtggtcat
gaaaaccactcgatgttttggagaattatgaagccgaagggtggtggagaaccaacaggg
gcgatcgcatctgctatcaaacaaaactttggcaattttgctgcctttaaaaagcagttt
aacgaagcgggtgccagtcgttttggcagcggttgggtttggttagtccgcaccaaagat
ggcaaacttgcagtgacaacaacagctaatcaagacagtcccttcagtgaaggcaattac
ccaattatgggcaatgacgtgtgggaacacgcatattacctgaagtaccagaaccgtcgg
gctgactacttggatgcttggtggaatgtcctgaactgggatgagataaataaacggttt
gcgcaagcgagcaaagcagcgtga

DBGET integrated database retrieval system