KEGG   Nostocales cyanobacterium HT-58-2: BZZ01_30265Help
Entry
BZZ01_30265       CDS       T04905                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ncn  Nostocales cyanobacterium HT-58-2
Pathway
ncn00010  Glycolysis / Gluconeogenesis
ncn00020  Citrate cycle (TCA cycle)
ncn00620  Pyruvate metabolism
ncn01100  Metabolic pathways
ncn01110  Biosynthesis of secondary metabolites
ncn01120  Microbial metabolism in diverse environments
ncn01130  Biosynthesis of antibiotics
ncn01200  Carbon metabolism
Module
ncn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ncn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BZZ01_30265
   00020 Citrate cycle (TCA cycle)
    BZZ01_30265
   00620 Pyruvate metabolism
    BZZ01_30265
Enzymes [BR:ncn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BZZ01_30265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding MadL GCV_H
Motif
Other DBs
NCBI-ProteinID: ARV62341
UniProt: A0A1Y0RUF0
LinkDB All DBs
Position
complement(7281597..7282922)
Genome map
AA seq 441 aa AA seqDB search
MSIYEVFMPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVESFYEGYLAHI
VVQAGETAPVGSAIALLAETEAEIETAIAQASSGSTAVKHEESAASSGKTAQTTQVATPA
ASQNGTSSRSNGRLVASPRARKLAKELKVDLSGISGSGPHGRIVAEDVEAAAGRSSTQPA
SVTPIAPPQPAPTITPVTPTPTKVAPAPTPTPAIAAVPGQIVPLTTLQNAVARNMVASLS
VPVIHIGYTITTDALDKLYKQIKSKGVTMTALLAKAVAVTLAKHPLLNASYSEQGIVYHS
SINIAVAVAMEDGGLITPVLQNADMVDIYSLSRNWKSLVERARAKKLQPEEYSSGTFTVS
NLGMFGVDRFDAILPPGQGSILAIGASRPQVVATADGLFGVKQQMQVNITCDHRIIYGAH
AAEFLQDLAKLIETNPESLML
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgagcatttacgaagtatttatgccggcgctaagttccaccatgacggaaggtaaaatt
gtttcctgggtaaaatctcctggagacaaagtggaaaaaggcgaaacagtggtggttgtc
gagtcagataaggcagatatggatgtggaatccttctatgaaggatatcttgcccatatt
gtagtgcaagctggtgaaacagcccctgtgggatctgcgatcgccctgttagcagaaact
gaagctgaaatcgaaactgcgatcgctcaagcgagttctggaagtaccgctgttaaacat
gaagaaagtgctgccagttccggaaaaacggcccagacaacccaagtcgcaacacctgct
gcttctcaaaacggaacctctagccgttcaaatggtcggctcgtagcttcacctcgagct
cgcaagttagcgaaggaactaaaagttgatttgagtggtatttctggtagcggtccccac
ggtcgcatcgtcgctgaagatgtagaagcagctgctggaagatctagcacacaaccagcc
tcagtcactcctatcgcacctccacaaccagcgccaactataaccccagttacacctaca
cccaccaaagtagctcctgcacctacacccacgccagcaattgctgcagttccgggtcaa
atagtacctttgacgactctgcaaaatgctgtcgcacggaacatggtagccagcttatct
gtgcctgtgattcatataggttacacaattaccactgatgcgctagacaagctttacaaa
caaataaagtccaaaggtgtaacgatgacagcgttactggcaaaagccgtagcagtcacc
ctggcaaaacatccgctgcttaatgccagctactcagaacaaggaattgtgtaccattcc
agtattaatattgccgtggcagtggcaatggaagatgggggattgatcacaccagtgttg
cagaacgcagacatggtagatatatattctctctcgcgcaattggaaatcattggtagaa
cgcgccagagcgaaaaagctacaaccagaagagtatagtagtggcacttttacggtgtca
aacttagggatgttcggtgtagatagatttgatgcgattttgcctcctggacaaggttct
attttggcaattggggcatctcgtccgcaagtcgtagcaacagctgatggtttatttggc
gtcaagcaacagatgcaggtaaatattacttgtgatcaccgcattatttatggtgcccat
gcagcagaattcttacaagatttggcgaagttgattgagacaaatcccgaatctttaatg
ctgtag

DBGET integrated database retrieval system