KEGG   Nostocales cyanobacterium HT-58-2: BZZ01_30265
Entry
BZZ01_30265       CDS       T04905                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ncn  Nostocales cyanobacterium HT-58-2
Pathway
ncn00010  Glycolysis / Gluconeogenesis
ncn00020  Citrate cycle (TCA cycle)
ncn00620  Pyruvate metabolism
ncn01100  Metabolic pathways
ncn01110  Biosynthesis of secondary metabolites
ncn01120  Microbial metabolism in diverse environments
ncn01200  Carbon metabolism
Module
ncn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ncn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BZZ01_30265
   00020 Citrate cycle (TCA cycle)
    BZZ01_30265
   00620 Pyruvate metabolism
    BZZ01_30265
Enzymes [BR:ncn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BZZ01_30265
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding MadL GCV_H
Other DBs
NCBI-ProteinID: ARV62341
UniProt: A0A1Y0RUF0
LinkDB
Position
complement(7281597..7282922)
AA seq 441 aa
MSIYEVFMPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVESFYEGYLAHI
VVQAGETAPVGSAIALLAETEAEIETAIAQASSGSTAVKHEESAASSGKTAQTTQVATPA
ASQNGTSSRSNGRLVASPRARKLAKELKVDLSGISGSGPHGRIVAEDVEAAAGRSSTQPA
SVTPIAPPQPAPTITPVTPTPTKVAPAPTPTPAIAAVPGQIVPLTTLQNAVARNMVASLS
VPVIHIGYTITTDALDKLYKQIKSKGVTMTALLAKAVAVTLAKHPLLNASYSEQGIVYHS
SINIAVAVAMEDGGLITPVLQNADMVDIYSLSRNWKSLVERARAKKLQPEEYSSGTFTVS
NLGMFGVDRFDAILPPGQGSILAIGASRPQVVATADGLFGVKQQMQVNITCDHRIIYGAH
AAEFLQDLAKLIETNPESLML
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgagcatttacgaagtatttatgccggcgctaagttccaccatgacggaaggtaaaatt
gtttcctgggtaaaatctcctggagacaaagtggaaaaaggcgaaacagtggtggttgtc
gagtcagataaggcagatatggatgtggaatccttctatgaaggatatcttgcccatatt
gtagtgcaagctggtgaaacagcccctgtgggatctgcgatcgccctgttagcagaaact
gaagctgaaatcgaaactgcgatcgctcaagcgagttctggaagtaccgctgttaaacat
gaagaaagtgctgccagttccggaaaaacggcccagacaacccaagtcgcaacacctgct
gcttctcaaaacggaacctctagccgttcaaatggtcggctcgtagcttcacctcgagct
cgcaagttagcgaaggaactaaaagttgatttgagtggtatttctggtagcggtccccac
ggtcgcatcgtcgctgaagatgtagaagcagctgctggaagatctagcacacaaccagcc
tcagtcactcctatcgcacctccacaaccagcgccaactataaccccagttacacctaca
cccaccaaagtagctcctgcacctacacccacgccagcaattgctgcagttccgggtcaa
atagtacctttgacgactctgcaaaatgctgtcgcacggaacatggtagccagcttatct
gtgcctgtgattcatataggttacacaattaccactgatgcgctagacaagctttacaaa
caaataaagtccaaaggtgtaacgatgacagcgttactggcaaaagccgtagcagtcacc
ctggcaaaacatccgctgcttaatgccagctactcagaacaaggaattgtgtaccattcc
agtattaatattgccgtggcagtggcaatggaagatgggggattgatcacaccagtgttg
cagaacgcagacatggtagatatatattctctctcgcgcaattggaaatcattggtagaa
cgcgccagagcgaaaaagctacaaccagaagagtatagtagtggcacttttacggtgtca
aacttagggatgttcggtgtagatagatttgatgcgattttgcctcctggacaaggttct
attttggcaattggggcatctcgtccgcaagtcgtagcaacagctgatggtttatttggc
gtcaagcaacagatgcaggtaaatattacttgtgatcaccgcattatttatggtgcccat
gcagcagaattcttacaagatttggcgaagttgattgagacaaatcccgaatctttaatg
ctgtag

DBGET integrated database retrieval system