KEGG   Nostocales cyanobacterium HT-58-2: BZZ01_32320Help
Entry
BZZ01_32320       CDS       T04905                                 

Gene name
aroB
Definition
(GenBank) 3-dehydroquinate synthase
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
ncn  Nostocales cyanobacterium HT-58-2
Pathway
ncn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ncn01100  Metabolic pathways
ncn01110  Biosynthesis of secondary metabolites
ncn01130  Biosynthesis of antibiotics
ncn01230  Biosynthesis of amino acids
Module
ncn_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:ncn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BZZ01_32320 (aroB)
Enzymes [BR:ncn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     BZZ01_32320 (aroB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2 Fe-ADH
Motif
Other DBs
NCBI-ProteinID: ARV62701
UniProt: A0A1Y0RVG6
LinkDB All DBs
Position
7755265..7756506
Genome map
AA seq 413 aa AA seqDB search
MVVDIKQKITLNNLQPIRQSFSVTFDYGVHFTNAVFDTKNPLLAKVIATDGETKPKKVLA
VVDSGLLQSRRMLLKQIATYSDHYADTLKLAADPIIVLGGEEAKNDPNELLKIHQTINEV
GLCRHSYLLGIGGGAVLDLVGYAAATAHRGIRLIRIPTTVLAQNDSGIGVKNGINAFGKK
NFLGTFAPPYAVLNDFTFLTSLNDRDWRSGIAEAVKVALIKDADFFEYISTYAHALVCRD
LNRMQNVIYRCAQLHMDHIANNGDSFEKGSSRPLDFGHWAAHKLEQLTNYRLRHGEAVAI
GIALDSTYSYLIGLLSRLEWRRILNTLLSLGFVLYLPELSEQMTEPEHPRSLFRGLNEFR
EHLGGELTLTLLQRIGKGVEIHEVDMSLFRQAIWLLGEFYNSSLPATGWECMM
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggtagtagacatcaagcagaaaattacacttaataatctgcaaccaatccgccaaagt
ttctctgtgactttcgactacggagtgcattttaccaatgcagtgtttgatacaaaaaac
cccttactggcaaaagtgattgctaccgatggggaaactaaaccaaaaaaagttttagca
gttgtagactcaggattattgcagtctcgacgtatgctcctcaagcaaatagctacctat
agcgatcactatgcagatacactgaaacttgctgctgatcctatcattgtgctgggagga
gaggaagccaaaaacgatccaaatgagcttttgaaaatccatcaaactattaatgaagtg
gggctttgccgtcactcttatctattaggaattggtggtggtgctgttttagatttagtt
ggatatgcagcagcaacagcgcatcggggaattcgtttgattcgcattcccacaacagtt
ttggcacaaaatgattctggtatcggggtaaaaaacggaatcaacgcctttggcaaaaag
aattttcttggaacctttgccccaccctatgcggttttgaacgattttacctttttgact
tccctcaatgaccgtgactggcgttctggaatcgcagaagcagtgaaagtggcgttgatc
aaagatgctgacttctttgagtacatctctacctacgctcatgcactcgtctgtcgagac
ttgaatagaatgcaaaatgtgatctatcgctgtgcccagttgcacatggatcacattgct
aacaatggggactcttttgaaaaaggttcatctcgtccattggattttggtcattgggca
gcgcacaaactagagcagctcacaaattacagattacgtcatggggaagcagtggcgatc
ggcattgctttagatagtacctattcctacttgatagggctgctttctcggttagagtgg
cggcgaatcttgaatactttgttatcgttaggctttgtgttgtatctaccagaactctct
gaacaaatgacagaaccggaacatcctcgcagcttgttccgagggctgaatgaatttcgg
gaacatttgggtggagaactaaccttaacgctgttgcaacgtataggaaaaggtgttgag
attcacgaagtagatatgtctctatttcggcaagccatttggttgttgggcgagttctac
aactcttcgttacccgccacaggttgggaatgtatgatgtga

DBGET integrated database retrieval system