KEGG   Nostocales cyanobacterium HT-58-2: BZZ01_32380Help
Entry
BZZ01_32380       CDS       T04905                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
ncn  Nostocales cyanobacterium HT-58-2
Pathway
ncn00500  Starch and sucrose metabolism
ncn01100  Metabolic pathways
ncn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ncn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BZZ01_32380
Enzymes [BR:ncn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     BZZ01_32380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase
Motif
Other DBs
NCBI-ProteinID: ARV62713
UniProt: A0A1Y0RRG5
LinkDB All DBs
Position
7773792..7776368
Genome map
AA seq 858 aa AA seqDB search
MQPIRTFNVSPSLPQRLEPLRKLAYNLHWDWNVETKDLFRRLDPDLWESSRHNPVLMLGT
ISQARLLEVVEDEGFLAQMDRAARQLEDYFHERTWYQKQRTGHLSDGKAQECYAYFSAEF
GLVDCLPIYSGGLGVLAGDHLKSASDLGLPLVGVGLLYQQGYFAQYLNADGWQQERYPIN
DFYNMPIHLERNPDGSELRIAVDYPGRTVYARVWRVQVGTVPLYMLDTNIEPNNPYDHDI
TDQLYGGDIDMRIHQEIMLGIGGVRMLKALGYNVTAYHMNEGHAAFSALERIRILIQEQG
LNYPEAKQVVASSNIFTTHTPVPAGIDLFPPDKVLHYLGYYADVFGLNKDQFLALGRENT
GDLSAPFSMAVLALKMATFSNGVAQLHGVVSRQMFKGLWQNVPTEEVPIKAITNGVHARS
CVAKSTQELYDRYLGPSWSSAPPDNPLWERMDAIPDEELWRNHERCRLDMVLYVRERLVK
HLHDRGASPSEIAQAQEVLDPNVLTIGFARRFATYKRATLWMRDVERIKRILLGNKDRKV
QFVISGKAHPKDIPGKELIRDINHFIREQGLEKQIVFVPNYDIYIARLMVAGCDVWLNTP
RRPREASGTSGMKAAMNGLPNLSVLDGWWDEADYVRTGWAIGHGEMYDDPNYQDEIEANA
FYDLLEKEVTPLFYDRDVDGLPRHWIDKMKDAIRLNCPFFNTARMVREYAQRAYFPASDR
FHTLTADNYAPAKELAAWKENLNAHWYDIKIKDVNVSSGADIEVSQLVNVKAKVDLATLT
NDDVRVELYQGAIDANGEIVNGVPVVMDYQGEEQNGLSIYTADIVYNTSGLQGLSLRVLP
NHKDLSSPYEPRLIVWAQ
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atgcagccaattcgcacttttaacgtctctccttcactaccacagcgacttgagccgctg
cggaaattagcatataacctgcactgggattggaacgttgagacaaaagatttattccgg
cgcttagatcctgacttatgggaatctagccgtcacaacccggttttgatgcttggtact
attagccaagcacgtctgttggaagttgtggaagatgaaggcttcctggcacaaatggac
cgagctgctcgtcagttagaagattattttcacgagcggacttggtatcaaaaacagaga
actggtcatttgtctgatggcaaagcacaagaatgctacgcctatttttcggctgaattt
gggttagtggattgtttgcctatctattctggaggtttgggagttcttgctggagatcac
ctcaaatctgccagtgatttaggtctacctttggttggtgtaggcttactctaccaacaa
ggttatttcgctcagtatcttaatgctgatggttggcagcaagaacgctatccaatcaac
gacttttacaatatgcccatacacctggaacgcaatcctgatggttcagaactgcggatt
gcggtggattatccaggacggactgtctatgctagggtttggcgcgtacaagtgggaaca
gtacccttgtatatgctagacactaatattgaacctaataacccttacgaccacgacatt
acagaccagctttacggtggcgacatcgatatgcgtatccaccaggaaattatgctgggt
atcggtggtgtacgaatgctcaaagcccttgggtataatgtaactgcgtatcacatgaat
gaaggtcacgcagctttctctgctttagagcgtattcgcatcctaattcaggaacaaggg
ctgaattatccggaagcgaagcaggtggtagcctctagtaatatctttacgactcacaca
ccagttcctgcaggaatagatttgttcccaccagacaaagttttgcactatctgggatac
tatgctgatgtctttggtctgaataaagaccaatttttagccttggggcgcgaaaatact
ggtgatttgtctgcaccttttagtatggcggtattggcactgaaaatggcaacattctct
aatggtgtggcacagttgcatggtgtggtgtcgcgccagatgtttaagggtttgtggcaa
aacgtacccacagaggaagtgccgattaaagcaattactaacggcgtccatgctcgtagt
tgtgttgctaaatcaacccaagaattgtacgatcgctacctaggaccaagctggtcttca
gcaccaccagataaccccttatgggaacggatggacgctatccctgatgaggagttgtgg
cgcaatcacgaacgctgtcgcttggacatggttttgtatgtgcgggaacgtcttgtgaag
catttacacgatcgcggtgcttctccctcagaaattgcccaagcacaagaagttctcgac
ccaaacgttttaaccattggctttgctcgtcgctttgccacgtacaaacgcgctactttg
tggatgcgggatgtagagaggattaagcggattttgttgggcaataaagaccgcaaagtg
caatttgtcatttctggtaaggcacaccccaaggatattcctggtaaggaacttatccgc
gatatcaatcactttatccgcgaacagggtttggaaaagcaaatcgtctttgttcccaat
tacgatatttacatcgcccggttaatggttgctggctgcgatgtctggttaaacacaccg
cgccgtccacgggaagcttctggtacgagtggtatgaaggcagctatgaatggtttgccg
aatttaagcgtactagatggttggtgggatgaagccgattatgttcgtaccggttgggcg
attgggcatggggaaatgtatgacgatcccaattaccaagatgagatagaagcaaatgct
ttttatgatttgctggaaaaggaagtcacacctttgttctatgaccgggatgttgatggt
ttgcctcgccattggattgataaaatgaaggatgcgatccggttaaattgtccgttcttt
aatacagcgcggatggtgcgagaatatgcacagagagcttatttccctgctagcgatcgc
ttccacactctcactgctgataattatgctccagctaaagaattagctgcttggaaagag
aatctgaatgcacattggtacgacatcaaaattaaggatgttaacgtatcttcaggagct
gatattgaagttagccaacttgttaacgttaaagccaaagttgacttagcaactttgacg
aacgatgatgtgcgggtggaactttaccaaggtgctattgatgccaatggtgagattgtc
aatggtgtgcctgttgtcatggattaccaaggagaagagcagaatggattaagtatttac
acggctgatattgtgtataatacttctggtttacaaggcttatctttgcgagtgttgcca
aatcataaagacctctctagcccttacgagccaaggctaattgtttgggcacaataa

DBGET integrated database retrieval system