KEGG   Nitrosomonas communis: AAW31_00580Help
Entry
AAW31_00580       CDS       T03942                                 

Definition
(GenBank) D-Ala-D-Ala carboxypeptidase
  KO
K01286  D-alanyl-D-alanine carboxypeptidase [EC:3.4.16.4]
Organism
nco  Nitrosomonas communis
Brite
KEGG Orthology (KO) [BR:nco00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AAW31_00580
Enzymes [BR:nco01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AAW31_00580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 Beta-lactamase2 SPOR DUF1381 Mfp-3 NUDE_C
Motif
Other DBs
NCBI-ProteinID: AKH36652
UniProt: A0A0F7KD52
LinkDB All DBs
Position
complement(144301..145539)
Genome map
AA seq 412 aa AA seqDB search
MFAVKGARREDFFALAVLLLLFLVSQVQANPRHASIVIDVDTAQVLHESHADASRYPASL
TKMMTLYMLFEAVEKRKMSLYTSMRVSTHAASMPPTNIRLRSGEVLSVRDAIPALIVRSA
NDVAAVVAEALGGTEANFGRMMTEKARKLGMHSTIFRNASGLPHSEQRTTARDMAILSMR
LMKDFPQYYHYFSTQSFRYKGMTYHSHNRMVRNISGVDGLKTGFIRASGFNVATSAKRGN
RRVVGVVMGGQSATSRDQHMAQLLDRSFTQSVMTKSARNVSSMVDTRPVVAMRASMSAPL
SKPASLQPRTIETAMMQQATQSEATVASQRAVVVDSNNRWGIQIGSYRAYDRAQAQAQAA
TRWVAGEVVVTEVEVRNRKLYRAQLVGLEKNEAHTACQSLVRQGMGCLVVRS
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgtttgctgtgaaaggtgcaaggagagaagatttttttgcccttgctgtattgttgtta
ctcttcctggtaagccaggtacaggcgaatcctcgccatgcttccatcgtgatcgatgtg
gatacggctcaagtgctgcacgagtcacatgctgatgccagccgttacccagcttctcta
accaagatgatgacgctctacatgttatttgaggcggtggagaaaaggaagatgagtctt
tatacttccatgcgggtatcgactcatgcagcatccatgccgccgaccaatatcaggcta
cgatcgggtgaggtccttagcgtacgtgatgcgattccagcattgatagtccgttctgcc
aacgatgtggcagcggtagtagccgaggcgctggggggtactgaagctaattttggccgc
atgatgacggagaaagcacgcaagcttggcatgcattccactattttccgcaatgcctcc
ggtctgccgcacagtgaacagagaactacggcccgggatatggcgatcttatctatgcgg
ttaatgaaggatttccctcagtactaccattatttttcgacccaatcctttcgttacaaa
ggtatgacctatcatagtcacaaccgtatggtacgtaacatatccggtgtagatggcctg
aaaaccggctttatccgggcttctggctttaatgtggctacttctgccaagcgaggaaac
cgacgggtggttggggtggtaatgggaggacaaagtgccacctcgcgcgatcagcatatg
gcccagttgctggatcgcagctttacgcaatcagttatgaccaagtcagcccgtaatgtc
agcagtatggtggatacgaggccagtcgtagccatgagagccagtatgtcggctcctctc
tccaaaccagcctccttgcagccaagaactatcgagacggccatgatgcagcaggctact
cagtcagaagccactgttgcgtcccagagggctgttgtggtggatagcaacaacagatgg
ggaattcagatcggttcctaccgtgcctatgaccgggcccaggcccaggcgcaagctgct
acccgctgggtagcaggtgaagtggtggtcactgaggttgaggttcgcaatcgcaaactc
tatcgagctcagttggtgggtttagagaaaaacgaagcgcatactgcctgccagagcctg
gttcgtcagggaatgggatgcctcgtggtacggtcctga

DBGET integrated database retrieval system