KEGG   Nitrosomonas communis: AAW31_01795Help
Entry
AAW31_01795       CDS       T03942                                 

Definition
(GenBank) phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
nco  Nitrosomonas communis
Pathway
nco00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nco01100  Metabolic pathways
nco01110  Biosynthesis of secondary metabolites
nco01130  Biosynthesis of antibiotics
nco01230  Biosynthesis of amino acids
nco02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:nco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AAW31_01795
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AAW31_01795
Enzymes [BR:nco01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     AAW31_01795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: AKH36824
UniProt: A0A0F7KDL6
LinkDB All DBs
Position
414767..415843
Genome map
AA seq 358 aa AA seqDB search
MKFQTDDLRIIGMHELTPPVELHREYPITETATEMVHLARQAIHRILHGEEDRLLVVTGP
CSIHDVDAALEYGARLKHLREVFKDQLHIVMRVYFEKPRTTIGWKGLINDPDLDNSFHIN
KGLRIARKLLLDLNNLGMPAATEYLDLISPQYLSDLISWAAIGARTTESQAHRELASGVS
CPIGFKNGTYGNLNIAIDAIGAASRPHHFLSVTKEGRTAIFATKGNEDCHIILRGGRKTN
YDSTSVAVAIEDLTKAKLPPYLMIDFSHANSHKDYRRQPEVSASVAEQIASGSDAICGVM
IESHLVEGNQKADGKKREELVYGQSITDGCISFEATEQVLSQLAEAVEKRRKGLKKAS
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttcagaccgatgatttacgcattatcggcatgcatgaacttaccccgccggtg
gaattgcaccgtgagtatcctattacggaaacagcaactgagatggttcacttagcgcgc
caagccattcaccggattttgcatggtgaagaggatcgcttgctagtagtgacaggaccc
tgctccattcatgatgtagatgcggcgctggaatatggtgctcgcttgaaacatttacgc
gaagtgttcaaggaccaactacatatcgttatgcgggtatacttcgaaaaaccacggacc
actatcggctggaaaggattaatcaacgaccctgacctggataacagctttcacatcaat
aagggtttgcgcatagcgcgtaaactactgctggatttaaataacctggggatgcctgcg
gctacggaatatcttgatttgatcagtccccagtatctgtcagatttgattagctgggcc
gcgattggggctcgcaccactgagagccaggcgcaccgcgaattggcatctggtgtctcc
tgtcctattggcttcaagaatggcacctatgggaatctaaacattgccatcgatgcgatt
ggcgccgcatctcggccgcatcattttctttcggttactaaagagggccgtaccgccatt
tttgctacgaaggggaatgaagattgccacatcatcctgcgcggcggacgcaagactaac
tacgatagcaccagcgtagctgtggccattgaagatttaaccaaagccaagctgccacct
tacctgatgattgatttcagtcatgccaacagccataaagactaccgacgccagccggag
gtaagcgccagtgtggcagagcagattgcgagtggaagtgatgccatctgcggcgtgatg
atcgaaagtcatctggttgaaggcaatcaaaaagcagatggcaagaaacgtgaagaatta
gtctatggacaaagcattaccgatggctgcatcagcttcgaggcaaccgaacaggtttta
tctcaattagcggaagccgtggagaaacgcagaaaaggattaaaaaaggcctcataa

DBGET integrated database retrieval system