KEGG   Nitrosomonas communis: AAW31_06130Help
Entry
AAW31_06130       CDS       T03942                                 

Definition
(GenBank) ribonuclease II
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
nco  Nitrosomonas communis
Brite
KEGG Orthology (KO) [BR:nco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nco03016]
    AAW31_06130
Enzymes [BR:nco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     AAW31_06130
Transfer RNA biogenesis [BR:nco03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    AAW31_06130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB
Motif
Other DBs
NCBI-ProteinID: AKH37485
UniProt: A0A0F7KAV4
LinkDB All DBs
Position
1344759..1346609
Genome map
AA seq 616 aa AA seqDB search
MNVFYEESGTFKVGAVLADNTTSLQVEASHGKRSKIKASAVLLRFEMPSLYEFMYQAQQV
AADLDTDFLWECCTNSEEFSSHTLAADYFGHSPSPVEVAAIMILLNNSPMYFYKKGQGRY
KAAPAEALRAALASQEKKRLEAEQQTRYKQQLSTFTLPEEFRPQLDDLLYKPNKNTIEWK
ALEAACTATKLSVPKLLEKCGAISSTHDYHFNQFLREHFPEGIDFNLPEVDNIFRDYENL
PIAEVAAFSIDDATTTEIDDAFSVTPLALGSFRIGIHIAAPALGITPGSHLDKVAAKRLS
TVYLPGQKITMLPEKTIDFYTLSETRLCPAISLYLDVADDFTVTASQSRIEKIRIVANLR
HDTLEQQFNEDTLRKNLTNYPFANELSLLWNFSRKMEIFRGKENDLNNEKIDYSFFVEQD
RIIIQERRRGSPIDRVVSELMIYANTEWGKQLADAGIAGIYRSQNGGKVKMSLSPAPHQG
LGVAQYAWSSSPMRRYIDLINQRQLIALLKDAIPPYSKESDELLISMRDFEQAYSIYSDF
QRAMERYWCLRWLLQENIQVTGAQVIKENLVKLDRIPFIVRVSSLPDLLPGTIVKLELSQ
IDLIECTLNTRFLSKE
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgttttttacgaagaatccggtacttttaaggttggcgccgttcttgcggacaat
acaacttctttacaagtagaagcatcgcacggtaaacgctccaaaatcaaagcttccgca
gtattgttaaggtttgagatgccgtctttatatgaatttatgtatcaggcacagcaggtt
gctgctgatctggatacggattttctctgggaatgctgcacaaatagcgaagaattttcg
agccatactttagctgctgattattttgggcactcacctagtccagtagaagtcgctgca
atcatgattctcctgaataattcgcccatgtatttttacaaaaaaggacaagggcgttat
aaagccgctccagctgaagctttacgagcagcgcttgccagccaggaaaagaaacgattg
gaagcagaacaacaaactcgctataagcagcaactgagtaccttcacgcttcctgaagaa
ttcagaccacaattggatgacctactttataaaccaaataaaaataccattgaatggaaa
gcgctcgaagcagcctgtactgccaccaagctcagcgttcccaaattattggaaaaatgt
ggtgccatctcctctacccacgattatcacttcaatcaatttctgcgagagcatttcccg
gaaggtatcgatttcaatctacctgaagtagataatatttttcgtgattatgaaaattta
ccgatagcagaggtagccgctttcagtattgacgatgcgaccaccactgaaattgatgat
gctttctcagttaccccgctcgctctgggaagctttcgtattggcatccatatagcagca
ccagccttaggcattaccccgggttctcatttggataaagtagctgcaaaacgcctttcg
actgtttatctacctgggcagaaaattaccatgctgcctgaaaaaacgatcgatttttat
actctcagcgaaacacgattatgtccagccatttcgctctatctggatgtagcagacgat
tttaccgtaacagcttctcaaagccgcatagaaaaaatcagaatcgtcgccaatctacgc
cacgacaccttggaacaacagtttaatgaagataccttgagaaaaaatctcacaaattac
ccttttgcgaatgagttgagtctactgtggaatttttcgcgcaaaatggaaatcttccga
ggcaaggaaaatgacctcaataatgaaaaaattgattacagcttttttgtggagcaggat
cgcattattattcaagagcgtcgacgcggctcaccaatcgacagagttgtttctgaattg
atgatttatgccaatactgaatggggcaaacaacttgccgatgcgggaatcgcaggtatt
tatcgcagccaaaatgggggaaaagtaaaaatgagtctttctccagcccctcatcaggga
ctcggggtggcccaatatgcttggagcagctctcccatgcgccgttacatagatttaatt
aatcagcggcagcttatcgcattactcaaggatgccattccaccttattccaaagagagc
gatgaattgttgatatccatgcgggattttgaacaagcttatagtatatatagtgacttt
caacgcgctatggagcgttattggtgtttgcgctggttgctacaggaaaacattcaagtg
accggcgcacaagtcattaaagaaaacctggtaaagctcgatcgcattcctttcatcgtg
cgagtgtcttcattaccagacctgttaccgggcacaattgttaagttagaattatcccaa
attgacttgattgaatgcaccttgaatacacgatttttatctaaagaataa

DBGET integrated database retrieval system