KEGG   Nitrosomonas communis: AAW31_06725Help
Entry
AAW31_06725       CDS       T03942                                 

Gene name
rbcL
Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
nco  Nitrosomonas communis
Pathway
nco00710  Carbon fixation in photosynthetic organisms
nco01100  Metabolic pathways
nco01120  Microbial metabolism in diverse environments
nco01200  Carbon metabolism
Module
nco_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:nco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AAW31_06725 (rbcL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AAW31_06725 (rbcL)
Enzymes [BR:nco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     AAW31_06725 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N OMPdecase
Motif
Other DBs
NCBI-ProteinID: AKH37577
UniProt: A0A0F7KFK2
LinkDB All DBs
Position
1479586..1481061
Genome map
AA seq 491 aa AA seqDB search
MASETIKEGKERYKSGVIPYKKMGYWEPDYIPKDTDVIALFRVTPQEGVEPEEAAAAVAG
ESSTATWTVVWTDRLTACELYRAKAYQVDPVPNTGPGTKTEQQYFAYIAYDLDLFEEGSI
ANLTASIIGNVFGFKAVKALRLEDMRIPVAYLKTFQGPATGIVVERERLDKFGRPLLGAT
TKPKLGLSGRNYGRVVYEGLKGGLDFMKDDENINSQPFMHWRDRFLFCMEAVNKASAATG
EVKGHYLNVTAATMEDMYERAEFAKSLGSAIIMIDLVVGYTAIQSMAKWARKNDMILHLH
RAGNSTYSRQKNHGMNFRVICKWMRMAGVDHIHAGTVVGKLEGDPLMIKGFYDTLRETRT
EKNLEHGLFFDQEWASLRKVMPVASGGIHAGQMHQLLDYLGEDVVLQFGGGTIGHPQGIQ
AGATANRVALEAMIMARNEGRDYVKEGPEILAEAAKWCTPLKLALDTWKDITFNYESTDT
ADFVPSATASV
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggcttcagaaactattaaagaaggaaaagaacgttataaatccggtgtaatcccctac
aaaaaaatgggctactgggaaccggactatattcccaaagacaccgatgtgattgcgttg
tttcgtgtcacaccacaagagggtgtggaaccggaagaagcagccgcagccgtcgctggc
gaatcctcaactgcaacctggactgtggtttggaccgaccgtctaacagcgtgcgagtta
tatcgcgctaaagcatatcaagttgatccagttcctaatactgggccaggtaccaaaacc
gaacagcaatattttgcatatatcgcctatgacttggatctgttcgaggaaggatcgatt
gcaaatttaaccgcttccatcatcggtaacgtattcggcttcaaagcagtgaaagcattg
cggctggaggacatgcgtattccggttgcctatctcaaaacattccaaggaccagcaact
ggtattgtggtcgaacgtgaacgcttagataaatttggccgaccattactcggcgccaca
accaaaccgaagttagggttatccggtcgcaactatggtcgagtggtttacgagggactc
aaaggcggcctcgatttcatgaaagacgatgaaaatatcaattcgcaacctttcatgcac
tggcgcgatcgcttcttattctgtatggaggcagttaataaagcatcagccgctacaggt
gaagtcaaagggcattatctcaatgtcacggcagctaccatggaagacatgtacgaacgt
gctgaatttgccaaatcgctgggctcggccattatcatgatcgatttggtggttggttac
acggccatccaatcgatggcgaaatgggctcgcaagaacgatatgatcttgcatttgcat
cgtgctggtaattcgacttattcccggcaaaaaaatcatggcatgaacttccgggtcatt
tgtaagtggatgcgcatggccggagttgaccatattcatgctggaaccgttgtcggaaaa
ctggaaggagacccactcatgatcaaaggtttctacgataccttgcgtgaaaccagaacc
gagaaaaatcttgaacatggcctgttctttgatcaagaatgggcatccttgagaaaagtg
atgccagtggcatccggtgggattcatgccggccaaatgcaccaattgctcgattacttg
ggtgaagacgtggtgttgcaattcggtggcggtactatcgggcatccacaaggcattcaa
gcaggcgcaaccgctaaccgcgtagcactcgaagccatgatcatggcgcgtaatgaaggc
cgcgattatgtcaaagaaggacctgaaattctcgccgaagcagcgaaatggtgtacgcca
ttgaaattggcattggatacttggaaggatatcacgttcaactatgaatccaccgacacc
gcagattttgtaccttcagccactgccagtgtttaa

DBGET integrated database retrieval system