KEGG   Nitrosomonas communis: AAW31_06730Help
Entry
AAW31_06730       CDS       T03942                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
nco  Nitrosomonas communis
Pathway
nco00630  Glyoxylate and dicarboxylate metabolism
nco00710  Carbon fixation in photosynthetic organisms
nco01100  Metabolic pathways
nco01110  Biosynthesis of secondary metabolites
nco01120  Microbial metabolism in diverse environments
nco01130  Biosynthesis of antibiotics
nco01200  Carbon metabolism
Module
nco_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:nco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AAW31_06730
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AAW31_06730
Enzymes [BR:nco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     AAW31_06730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AKH37578
UniProt: A0A0F7KEK2
LinkDB All DBs
Position
1481083..1481517
Genome map
AA seq 144 aa AA seqDB search
MMTNPGNRLTQGQFSFLPPLTDKQISAQIKYALNNGWAIGIEYTDDPHPRDTYWEMYGNP
MFDLKDPAGILMEINNCRKTFPNHYIRVTAFNSTRGFESPTMSYIVNRPEKEPGFGLIRR
ETAGRNIQYSIHSYATDKPEGERY
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgatgacaaatccaggcaatcgtctcacacaagggcagttttcttttctgccgccgtta
acggataaacaaatctcagcgcaaatcaaatatgcgttgaacaatggatgggcaatcggt
attgagtacacggatgaccctcacccgcgcgatacctactgggaaatgtacggtaatcca
atgtttgatttgaaggatcctgcggggatactgatggaaatcaacaattgtcgtaaaaca
tttcccaatcactatatccgggtaactgctttcaactctacacgtggttttgaaagcccg
accatgtcttacattgtcaatcgacctgaaaaagaacctggttttggtctgattcgtcga
gaaacggcaggtaggaatattcaatattccatccattcttatgcaacggataaaccggaa
ggagaacgttactaa

DBGET integrated database retrieval system