KEGG   Nitrosomonas communis: AAW31_06730Help
Entry
AAW31_06730       CDS       T03942                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
nco  Nitrosomonas communis
Pathway
nco00630  Glyoxylate and dicarboxylate metabolism
nco00710  Carbon fixation in photosynthetic organisms
nco01100  Metabolic pathways
nco01120  Microbial metabolism in diverse environments
nco01200  Carbon metabolism
Module
nco_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:nco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AAW31_06730
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AAW31_06730
Enzymes [BR:nco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     AAW31_06730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AKH37578
UniProt: A0A0F7KEK2
LinkDB All DBs
Position
1481083..1481517
Genome map
AA seq 144 aa AA seqDB search
MMTNPGNRLTQGQFSFLPPLTDKQISAQIKYALNNGWAIGIEYTDDPHPRDTYWEMYGNP
MFDLKDPAGILMEINNCRKTFPNHYIRVTAFNSTRGFESPTMSYIVNRPEKEPGFGLIRR
ETAGRNIQYSIHSYATDKPEGERY
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgatgacaaatccaggcaatcgtctcacacaagggcagttttcttttctgccgccgtta
acggataaacaaatctcagcgcaaatcaaatatgcgttgaacaatggatgggcaatcggt
attgagtacacggatgaccctcacccgcgcgatacctactgggaaatgtacggtaatcca
atgtttgatttgaaggatcctgcggggatactgatggaaatcaacaattgtcgtaaaaca
tttcccaatcactatatccgggtaactgctttcaactctacacgtggttttgaaagcccg
accatgtcttacattgtcaatcgacctgaaaaagaacctggttttggtctgattcgtcga
gaaacggcaggtaggaatattcaatattccatccattcttatgcaacggataaaccggaa
ggagaacgttactaa

DBGET integrated database retrieval system