KEGG   Nitrosomonas communis: AAW31_09125Help
Entry
AAW31_09125       CDS       T03942                                 

Gene name
argJ
Definition
(GenBank) ornithine acetyltransferase
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
nco  Nitrosomonas communis
Pathway
nco00220  Arginine biosynthesis
nco01100  Metabolic pathways
nco01110  Biosynthesis of secondary metabolites
nco01130  Biosynthesis of antibiotics
nco01210  2-Oxocarboxylic acid metabolism
nco01230  Biosynthesis of amino acids
Module
nco_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:nco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    AAW31_09125 (argJ)
Enzymes [BR:nco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     AAW31_09125 (argJ)
    2.3.1.35  glutamate N-acetyltransferase
     AAW31_09125 (argJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArgJ
Motif
Other DBs
NCBI-ProteinID: AKH37942
UniProt: A0A0F7KGJ4
LinkDB All DBs
Position
2011815..2013044
Genome map
AA seq 409 aa AA seqDB search
MPVNIPPLLPQQLLPIRGISLGIAEAGIKRPDRKDLLVIALDDNVKVAGVFTKNRFCAAP
VIVAKAHLSAASSIRALVINTGNANAGTGEEGIAHARVTCTALAKLLGCEPQQILPFSTG
VIMEPLPVDRIIAGMPRAVSELKCDNWFAAAQAIMTTDIVPKGISSQIQINGTTITITGI
AKGSGMIHPNMATMLGYIATDAKISQSLLQEMVRHVADHSFNRITVDGDTSTNDALVLIA
TGKANHSQEIDRKSPEFNLLQDTITEVAVKLAQMIVRDGEGATKFITVQVEKGSTQQECA
QVAYAIAHSPLVKTAFFASDPNLGRILAAIGYAGIDDLDVNNIELYLNEVLVAEQGGRAK
NYCEEEGQRVMKQSEITVRVILNRGVATTSIWTCDFSYDYVKINADYRS
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgccagttaatattcctcccttgttacctcaacaattattaccgattcggggcatatct
ctgggtattgctgaagcaggaattaaacgacctgatcggaaagatctcttggtgattgcg
cttgatgacaatgtaaaagtagccggtgtgtttactaagaatcgcttttgtgctgcaccc
gtcatcgtggcgaaggcacatctctcggcggccagctcaattcgtgcattggtgattaat
accggtaacgctaatgccggtaccggagaagaaggtatcgcccatgcacgcgtgacttgt
actgcgctggctaagctgcttggctgcgagccccagcaaatattaccgttttctacaggc
gttattatggaacccttaccggttgacagaattattgcgggtatgcctcgagccgtgagc
gaacttaaatgtgataactggtttgctgccgcgcaagcgattatgacgaccgatattgtt
cccaaaggtatttccagtcagattcaaattaatggcactaccattacaataacgggtata
gccaagggttcgggtatgattcatccaaatatggcaaccatgctgggatatatcgccaca
gatgccaagatatctcaatcgctattacaggagatggtacgccatgtggcggatcattcc
tttaaccggattacggtggatggggatacctccaccaatgatgcgttagtattgatagca
acaggcaaggccaatcactcgcaggagattgatcggaaaagcccggagtttaatttgctg
caagataccataacggaagtagctgtgaagctggctcagatgattgtacgcgatggggaa
ggtgcaactaaatttattacagtgcaggtagaaaaaggtagcacacagcaagaatgtgca
caggttgcttatgccatcgcgcattcgccattagtcaagaccgctttctttgcatctgac
cctaatctggggagaatacttgctgcgattgggtatgctggtatagacgatctcgatgtt
aacaatattgagctttacctgaatgaagtgttagtcgcagaacagggtggtagagcaaaa
aactattgtgaggaggaggggcagcgcgtcatgaagcaatctgagattaccgtgcgggtg
atattaaaccggggtgtggccacaactagcatatggacgtgtgatttttcttacgactat
gtgaaaatcaacgcagattatcgcagctga

DBGET integrated database retrieval system