KEGG   Nitrosomonas communis: AAW31_09190Help
Entry
AAW31_09190       CDS       T03942                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
nco  Nitrosomonas communis
Pathway
nco00620  Pyruvate metabolism
nco00680  Methane metabolism
nco00710  Carbon fixation in photosynthetic organisms
nco01100  Metabolic pathways
nco01120  Microbial metabolism in diverse environments
nco01200  Carbon metabolism
Module
nco_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:nco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AAW31_09190
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AAW31_09190
   00680 Methane metabolism
    AAW31_09190
Enzymes [BR:nco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AAW31_09190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AKH37955
UniProt: A0A0F7KBW6
LinkDB All DBs
Position
2024884..2027682
Genome map
AA seq 932 aa AA seqDB search
MSSDAGVSVYSDNNMSEEKDKPLREDIRMLGRMLGDTLREQEGEATFELVETIRQTAVRF
RREQDPKARQELDMILNRLSNKATIAVVRAFSYFSLLSNIAEDLHHNRRRRAHLRQGSSP
QPGSVTLALERVLASGIDNASLDNFFAQAMISPVLTAHPTEVQRRSILDCQLTIQRLLQE
RDRIQLTPNELRHNEEALRAAIQILWQTRMLRSVRLTVHDEIENGLIYYTYTFLSQVPYI
YAKIEDLLERHKGKEAPHVASFLRIGSWIGGDRDGNPFVTHQVMLHAAERQATLVFDFYM
DEVSKIGRTMSLAERLIHVSEELEQLAAASPDIPASRIDEPYRRAFLGIYARLAATSRQR
GLAAMPREPVNPTEPYADSAEFIHDLDVVIDSLKQHRSDWLARGALRNLRRAVDVFGFHL
ASLDMRQHSKVHEQVVAELFARGTRRDNYLELSASERMKWLLAEISSLRLLHSPYLTYSE
PTQSELRILQMAAEIQRRFGHAALPNYIISMTTGVINILEVALLLKEAGLLRAGEKPQLG
LNIIPLFETIEDLRSCSTVMDELFSLPYYRKLLDSRGNVQEVMLGYSDSNKDGGFLTSNW
EIYKAEIELTKIFAKHQVELRLFHGRGGTVGRGGGPSYQGIMAQPPSSVNGQIRLTEQGE
VVASKYTDPEIGRRNLETLVAATIEATLLSHDAIQENAAHYYHVMETLSSSAFAVYRNLV
YETPGFKQFFQESTPIREIAGLHIGSRPSSRKPSDRIEDLRAIPWVFSWSLNRTMLPGWY
GFGSAVEAFVQQAQGEETGLQLLQEMYQKWPFLQTLLSNMDMVLAKTDMGIASRYAELVT
DATLRNQIFGRIQAEWERSVKWLFAITGHTALLQENPTLARSIRIRTPYIDPLNHLQIEL
LRRYRAGDDVEQVHRSIHLTINGVAAGLRNSG
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atgagttctgacgctggtgtaagtgtttattctgacaacaatatgagcgaggaaaaggat
aagcctttgcgtgaggacatccgtatgcttggtcgcatgctgggggatactttgcgggag
caggaaggggaggcaacgtttgaattggtcgaaaccattcgtcaaacggcagttcgcttt
cgtcgtgaacaagatcccaaagcgcgtcaagagcttgacatgatcttgaaccggttaagc
aataaggcaacgatcgcggtcgtgcgcgcctttagttatttttcactgctctccaatatt
gcggaggatctgcatcataaccggcggcggcgagctcatttgcgccaaggatcttcacct
cagcccggcagtgttacgctcgcactggaacgtgtgctggcaagtggcatagataacgcg
agcttggataatttttttgctcaagcaatgatctctccggtattgacggctcatcctacc
gaggttcagcgtaggagcatactcgattgtcaattgactattcagcgcttattgcaggaa
cgcgaccgtatccagctcacgcctaacgaattgcgccacaatgaagaagcgttgcgtgct
gccattcagattctatggcaaacccgtatgctgcggtcagtacgtcttaccgttcatgat
gaaattgagaatggccttatttattatacttataccttcctgagccaagtaccttatatc
tatgccaagatcgaggatctgctggagcgtcataagggtaaagaggcgccccatgtggcc
tcttttttgcgtataggtagttggataggtggtgaccgggatggcaacccttttgtgacg
catcaggttatgttgcatgcggcagagcgccaagccacgctcgtattcgatttttatatg
gacgaagtcagcaagattgggcggaccatgagtctggctgagcgtctgatccatgtaagt
gaggaacttgagcaattagctgctgcttcgccagatattcctgcgagccgcattgatgag
ccatatcgacgagcattcctcggcatttatgcacgtttggctgcaaccagtcggcaacgt
gggcttgcagcgatgccacgagagccagtcaatccaacagaaccttatgcagacagtgca
gagtttatccatgatcttgatgtcgtgatcgattcactcaagcagcacagatcagattgg
ctggcgcgcggtgcattgcgtaatttacggcgagcagtggatgtatttggattccacctg
gcctcacttgatatgcggcagcatagtaaagtacatgagcaggttgttgcggagctattt
gcgcgtggcactcgtcgggataattatctcgagctgtcggcgagtgagcgtatgaaatgg
ctattggcagaaatcagtagcctgcgattactccattccccttatttgacctactccgaa
ccgacacaaagtgaattgcgaattttgcaaatggcagcagaaatccagcgccgctttggt
catgctgcgctgccaaattacattatttccatgacaacaggtgtcatcaatatcctggag
gtcgcactattattgaaagaggcgggtttacttcgggcgggcgagaagccgcagttgggt
ctgaatattattccattatttgaaaccattgaggatttacgcagttgcagcaccgttatg
gatgaattattttcattgccatactaccgaaaattgctggattcgcgtggcaatgtacag
gaagtcatgctcggctattcggatagtaacaaagatgggggctttcttacttccaactgg
gaaatatacaaagctgaaattgaattgacgaaaatttttgccaagcaccaggtggaacta
cgcttgtttcacggacgcggcgggacggttggacgcggtggcggccccagctatcaaggg
atcatggcgcaacccccgagcagtgtgaacgggcagatacggttgaccgaacagggagag
gttgtggcgagtaaatatacggatcctgaaataggacgccgcaatctggaaacattggtg
gcggcaacgattgaggcgacattgctgagtcatgatgccatccaggaaaatgctgcgcac
tattaccatgtcatggaaacgctctcatcctctgcatttgcagtctatcgcaatctggta
tacgaaacgcccggtttcaaacaatttttccaggaatccaccccgatccgggaaatcgcc
gggttgcacattggtagtcggccttcttcccgtaaaccttctgatcgaattgaagattta
cgggctattccctgggtattcagctggagtctcaatcgtaccatgctgccaggatggtat
ggttttggttcagcggtggaagcattcgttcagcaggcgcaaggggaggaaaccggatta
caattattacaagagatgtatcaaaaatggccctttttgcaaaccttgttatcgaatatg
gatatggtgttggcaaaaaccgatatggggattgcctcgcgctacgctgagttagtcact
gatgccaccttgcgtaaccaaatctttgggcgcatccaggcagaatgggaacgtagcgta
aaatggttgtttgcaatcacaggacatacagcgttgctgcaggaaaatcctaccttggcg
cgcagcattcgtattcgcacgccttatatcgatccgcttaaccatttacaaatagagttg
ctgcgtcgttatcgtgcgggggatgatgtagagcaagtacaccgctccattcatcttacg
ataaatggcgtcgcagcagggctgagaaatagcggttaa

DBGET integrated database retrieval system