KEGG   Nitrosomonas communis: AAW31_11395Help
Entry
AAW31_11395       CDS       T03942                                 

Definition
(GenBank) cytochrome C550
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
nco  Nitrosomonas communis
Pathway
nco00550  Peptidoglycan biosynthesis
nco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nco00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AAW31_11395
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:nco01002]
    AAW31_11395
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nco01011]
    AAW31_11395
Enzymes [BR:nco01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AAW31_11395
Peptidases and inhibitors [BR:nco01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   AAW31_11395
Peptidoglycan biosynthesis and degradation proteins [BR:nco01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   AAW31_11395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AKH39608
UniProt: A0A0F7KKK0
LinkDB All DBs
Position
complement(2507107..2508225)
Genome map
AA seq 372 aa AA seqDB search
MKSILWLVLCLAVFPVFAQQPTLSVAAKSYILVDFHTGKTLISQNEHERLEPASLTKLMT
AYVIFSELKQNRIKLDQVVPVSKAAWKMVGSRMFIQPNKPVTVDELIRGMIVQSGNDACV
ALAELIAGSEDMFAHKMNEEAARLGMINTNFTNSTGLSHPKHYSTAHDLALLSAAIIREF
PEFYPLYSLREYTYNGITQPNRNRLLWVDPTVDGMKTGWTVAAGYCLITSSQRDERRLIS
VVMGTASANARSKESQRLLNYGYQFFDTAHPYKKDQEITALQIWKGAQNTLKVGFDRDIY
FTLPKGQAEKIKAKMEYKQPVIAPINQGQEVGTVKFSLGDQEIAAYPLVSLETIGEAGIF
GRAWDSLHMLFN
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcattctttggttagtgctatgtttggcagtatttcctgtttttgcacagcag
cctaccttgtctgtcgcagcaaaatcttacatactcgttgattttcacaccggtaaaaca
ctgatcagtcaaaatgagcatgagcgccttgagccagcctcactaactaagctgatgaca
gcttatgtgattttttccgagctaaagcagaaccgtatcaaattggatcaagtggttccc
gtttctaaagcagcctggaaaatggtgggttctcgcatgtttattcaacccaataagccg
gtaacggtggatgaattgattcgtggcatgatcgtgcaatccggaaatgatgcctgtgtt
gcgctggccgaactgattgcgggttctgaagatatgtttgcccataagatgaatgaggaa
gcggctcgtttgggaatgatcaatacgaatttcaccaattcgactggattgtcccatccc
aaacattacagcacggcacacgatcttgcattgttgtcggccgctattattcgtgagttt
ccagagttttatcctctctattcactgcgtgagtatacctacaatggcattactcaaccc
aatcgtaatcgattgctgtgggtggatcctacggtagatggcatgaagacaggctggacg
gtggctgctggttactgtttgattacgtcatcccaacgggatgagcgcaggttgatttca
gtcgtgatgggaactgcctcagctaatgcacgttccaaggaaagtcaacgtttattgaat
tacggctatcagttctttgatacggcgcatccctataaaaaggatcaggaaattactgct
ctgcaaatctggaaaggggcacagaatacgctcaaggtagggtttgatcgtgatatctat
tttaccttgcccaaagggcaggctgaaaaaataaaggctaaaatggaatataagcaaccc
gtgattgcccctatcaatcaagggcaagaagtgggtaccgttaaattcagcctgggtgat
caggaaatcgcagcttatccactcgtttccctggaaacgataggtgaagccggtattttt
gggcgcgcctgggatagcctccatatgctctttaattaa

DBGET integrated database retrieval system