KEGG   Nitrosomonas communis: AAW31_12880Help
Entry
AAW31_12880       CDS       T03942                                 

Definition
(GenBank) thioester reductase
Organism
nco  Nitrosomonas communis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Condensation PP-binding AMP-binding_C AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: AKH38485
UniProt: A0A0F7KDB9
LinkDB All DBs
Position
complement(2847630..2852930)
Genome map
AA seq 1766 aa AA seqDB search
MNTRLIPSRSYPDNIVMHLQTLARERPTDIALIVVSANGDTLIDKQFDYVSLNLYVRAVA
AVLQDRFDQGDRILLLMDNDEHYVVGFLACLYAGMIAVPVFPPESMREQHLTRLLAIATD
AKARCILTTSEIIPLISEAAITQLADADILAVDAIMKNNRFGMASAWHERMPEKDEIAFL
QYTSGSTSTPKGVMVSHHNLMINARVFEEGMSIGENDIFVSWLPLYHDMGLIGGLLQPLH
RGIPAILMTPQFFIERPVRWLEVISRYRATVSGAPNFAFQLCIERVRSSQLQGLDLSTWR
VAFSGAEPVRRDTMRAFIERFSALGFPAGTIYPCYGLAEATLFVTGGVRGEGMIVHEFLP
DKLAQGQAEVATQGVPIVACGFPASNHSVKIMQPEKQIPLADGHVGEIWTDGLSLAQGYW
QRPQETAETFVDHEGARWLRTGDLGFIHARQLYIMGRLKDLIIIRGQNIYPQDIELVIEE
EVDAVRKGRIAAFSVEGKEGEGIGVAVEVSRNMQKLVSAEALVAALSEVVSAICHEPLSV
VVLLNPGALPKTSSGKLQRSACRQGWRERTLDAYAIYEYGHFVLGGSKPLPCLLEDETEL
ALAAIWETVLHRTGLKRGDHFFAIGGNSLSTVQVVAHISDRWHIPFLPRNLFQHPRLQEC
AAEIKRLASLKEVSQEANTCRLMPMRNEHYSLPLSYGQQRLWFLWQLDPDTTAYHVQHAL
RLSGMLDKQAFVASFQALIERHESLRTLFRISTEGVVEQVIQSTSSLAITDVDLLDWDVT
QREEQATAEAQHIILMPFDLTQGPLLRVALIRVAEYEYILVIVMHHIIADGVSMQILLNE
FAAYYQAYIQGKPAQLAHLPIQYVDYTVWQQKWLEAGEKEKQLAYWRSYLGESHPVLTLP
TDRVRRPVTSYPAARHSFDLPQAVLVKLRQFSFDRGATLFMSLMAAFQVLLFRHTGQQII
RIGVPVANRHRIETMSLIGFFVNTQVLQSQLHGRMPLAELLDQVREDAINAQAHQDLPFE
QLVEALHPQRDLRHNPLFQTTLNHLQKDYRSLQQCSGLAVTDYVLPEQAAQLELRLETVE
LPDGNVSASFIYASNLFHPALIERFTRHYLQILQHLSMQPTIAIGDIDLLDETDKQQLTL
WGGHQQTSFINHPVHHLIEHQADRCPHMTAVISGDIELSYAELNRRANKLAHRLIDLGVK
PEVRVGVALERSSVELIIGLVAILKAGGAYIPFDPEYPNDRLAYMMEDSRTRLLLTQSYL
SERLPYREGIQILELDTLDLSAVNEINPDITLHSDHLAYVIYTSGSTGRPKGVAVSHGPL
AMHLSAIKKIYGIQQGDHELMFFSMNFDAAAEQWMGPLTEGATLVLSSNHHLAGKGFVEL
IERHKIAILHLPPAYLRLLLPQIDRTRQWVRTCIAGGEAWYAADVIAARAIFQKARLVNA
YGPTETVVTPTAWIDQSNENALTSVIGEFAPIGQPVGERTLYVLDAELKLVPPGTAGELY
IGGKGLARGYLDRPALTSERFVANPFDQSGGRLYRTGDLVRWRDDRQLEYLGRLDDQIKL
RGFRVELGEIEARLLTLAGIREAAVIAHEGRHGLRLLAYVVLHDNTQLNASLLKTALTAT
LPDYMIPSQFIFLDMLPLNPNGKLDRKALPSPEQFDTPDYDPPVNLMEKTIAEIWAEALE
MPQVGLHNNFFDLGGHSLLLIKIKQKLEEHLAKQIAMVDLFKYTTVASLAKFLSQGKTGT
ASLSRHQARAQRQRGAFIQRKQERIQ
NT seq 5301 nt NT seq  +upstreamnt  +downstreamnt
atgaatacaagactgattccttctcgcagttatcctgacaatattgtgatgcatctgcaa
acgctcgctcgtgagcgaccgacagatatagctctgatcgtagtgagtgcgaatggcgat
acactcattgacaaacagttcgattatgtttcgctcaatttgtatgtcagggctgttgcc
gctgttttacaggatcgattcgatcaaggtgatcgaatactattgttaatggataacgat
gaacattatgtagtcggtttccttgcctgtctttatgcagggatgatcgcggtaccagtt
tttccacccgaatcaatgcgggagcaacatctgacaaggctgctcgcaattgcaaccgat
gcaaaggcgcgatgcattctgacgactagcgaaattataccgctgattagcgaggcagcg
attacgcaattggcagacgctgatattctagcggttgacgccataatgaaaaataacagg
tttggtatggcgtccgcatggcatgagcgcatgccggagaaagatgagattgcttttctg
caatatacttctggatcgacttctacacccaaaggtgtaatggtcagtcatcataatcta
atgatcaatgcccgggtttttgaagaaggcatgtcgatcggggagaacgatatcttcgtc
agttggctgccgctttaccatgatatgggattgattgggggattattgcagccgttacac
cgaggaattccggcaatacttatgacgccacagttttttatcgaacgtcctgtgcgctgg
ctagaagtcatttcacgctatcgcgccacagtaagtggcgcacctaattttgcctttcag
ttatgtatcgagcgcgtgagaagctcgcaattgcagggactcgatttatcgacctggcgt
gttgccttctcgggtgccgagcccgtgcgcagagacacgatgcgtgcttttatcgagcgt
tttagtgcacttggatttccggctggcactatttatccctgctacggtttggctgaagcg
acactgttcgtgacgggaggtgtgcgtggagaaggcatgatagtgcatgaatttttgccc
gacaagctggcacaaggtcaagcagaggtggcgacgcaaggtgtcccgatcgttgcctgt
ggttttcctgcttccaatcattcggtaaaaatcatgcaacctgaaaagcagattccgctg
gcagacggtcacgtcggcgaaatttggacggatgggctcagcctcgcacaaggctactgg
cagcgtccacaggaaactgctgaaacctttgttgatcatgaaggcgcacgctggttacgt
accggtgatctgggttttatccatgcgcgccagttatacatcatggggcgactcaaagat
ctcatcattattcgtggacaaaatatttatccccaggacattgagttagttatcgaggaa
gaagtggatgctgtacgtaaagggcggattgcggcattttcagtcgaaggaaaagaaggg
gaagggatcggtgttgcagtggaagtgtcacgcaacatgcagaaactcgtttctgccgag
gctctggtggcagccctcagcgaggtagtcagtgcaatttgtcatgagcccttgtctgta
gtggtactgctaaaccctggtgcacttcccaaaacttcgagtggcaagttacaacgctca
gcttgccgtcaaggttggcgcgagcgcacgctggatgcttatgccatctacgaatatggt
cattttgtgctcggtgggagcaaaccgctcccttgtctgttggaagatgaaacagagctt
gctttggcagctatttgggaaactgtgctgcaccgtacgggattgaagcgtggagatcat
ttctttgctattgggggtaattcactttctactgttcaggtcgtagcgcacatttcagat
cgttggcatattccgtttcttccgcgtaatctatttcagcacccacgactgcaagagtgt
gctgcggaaattaagcgtttggcatctttgaaggaagtttcacaagaagccaatacgtgt
cgccttatgcctatgcggaatgagcactatagcttgccattatcttacggccaacagcgt
ctttggtttctttggcaactcgatcctgacaccacggcctatcacgttcagcatgcgctg
cgattatcagggatgttggataaacaagcgtttgttgcgagctttcaggcattgatcgaa
cggcatgaatcattacgcaccttatttcgtatcagtacggaaggcgtggtcgagcaagta
atacaatcgacatcgtcattagcaataacggatgtcgatttgttggattgggatgttacg
cagcgtgaagagcaagcgacagcggaagcgcagcacatcattttgatgccctttgatttg
acgcaaggccctttgctacgagtggcattgatccgggtagctgagtacgaatatattctc
gttattgtcatgcaccatatcattgccgatggtgtgtccatgcaaatcttgttgaatgag
tttgcagcttattatcaggcgtatatccaaggaaaaccagctcaactcgctcatttacct
attcagtatgtagactacacggtttggcaacaaaaatggcttgaagcaggcgaaaaggaa
aagcagctcgcttactggcgaagttacctaggtgagtcacatccggttttaacattgcca
actgatcgagtacgacggcctgtaacgagttaccctgccgcacgtcacagtttcgatctg
ccacaagcggtattggtaaaacttcgccaattctcatttgatcgcggagcgaccctcttt
atgtcactaatggccgccttccaggtattgttatttcgtcatacagggcaacagattatt
cgcatcggtgtacccgtcgctaatcgccaccgtatcgaaacgatgagcctgatcggtttt
ttcgtcaatacacaggtcttacagagtcaattgcatgggcgtatgccgcttgctgaactg
ctggatcaagtgcgggaggatgcgatcaatgcccaggctcaccaggatttgccattcgaa
caactggtcgaagcactgcatcctcagcgagatttacgccataatccattatttcaaact
accctcaatcatttacagaaagactaccgtagtttgcagcaatgctctggactggcggtt
accgattatgtccttcctgagcaggcagcccagttggaactgagacttgaaaccgttgaa
ttacccgatgggaatgtatccgccagtttcatttatgcgtctaacctgttccatcctgct
ctgatcgagcgctttacgcgccactatctacaaattttgcagcatctttcaatgcagcca
accattgccatcggcgacatcgatttgctggatgaaacggataaacagcaacttacactc
tggggaggccatcagcagacttcattcatcaaccacccagttcatcatctgattgagcac
caggcagacagatgtccgcacatgacggcggtaatctcgggtgatatcgagctgagttat
gccgagctcaatcgtcgggcgaataagctcgcccatcggctcatcgacttgggtgtcaaa
cctgaagtgcgggtaggcgttgcactcgagcgaagttccgtcgagttgattatagggctt
gtggctattctaaaagcagggggggcgtatataccgtttgaccctgagtatcctaatgat
cgtctggcttatatgatggaagacagtaggactcgactgttgttaactcaatcttatctc
agcgagcgattgccttaccgcgaagggatacagatcctcgaacttgatacgcttgatctg
agtgcagtaaatgaaattaatcctgatattaccttacatagcgaccatctcgcttatgtg
atttacacctcggggtcgactggtcgacctaagggcgtggcggtttctcatggtccgcta
gccatgcatttatctgctatcaaaaaaatctatgggatccaacagggcgatcacgaatta
atgtttttttcgatgaatttcgatgcagcagcagagcagtggatgggaccgctgactgaa
ggggcgacgctggtgctttcttctaatcatcatttggcaggaaagggttttgttgagctg
atcgagcggcacaaaatagcgatcctgcaccttcctcctgcttatttgcgcttattactc
cctcaaattgatcgtacccggcaatgggtgcgtacctgtatagcagggggtgaagcatgg
tatgcagcagatgtgatcgcggctcgtgcgatatttcagaaagctcgtttggtgaatgct
tatggcccaactgaaacagtggtcacaccaaccgcatggattgatcagagcaatgagaat
gcgttaacgtcagtgatcggtgaattcgcaccgatcggccagccggtgggtgaacgcacg
ctctatgtgcttgatgctgagctcaagcttgtgccacccggcacagccggtgagctttat
attggagggaaaggattggcgcgcggttatctcgatcgtcccgctttgactagtgaacgc
tttgtagctaatccattcgatcagtcgggaggccgtctttatcggacaggagatttagtg
cgctggcgagacgatcgacagcttgagtatctcggtcgccttgatgatcagatcaagctg
cgtggttttcgtgtcgaattgggagaaatcgaggcacgcttgctcacgttagccgggata
cgtgaagctgcggtgattgcccacgagggacgtcatggtctccgcctgcttgcctatgtc
gttttgcacgacaatactcaattaaacgcgtcactattaaaaacagcgctgacagctacg
ctgccggactacatgatacccagccagttcattttcctggatatgctgcctcttaatccg
aacggcaagctagaccggaaagcgctaccttcccctgaacagtttgatacaccggattat
gacccacctgtcaatctgatggaaaaaaccattgcagaaatctgggctgaagccctagaa
atgcctcaagtcggtttgcacaacaacttttttgatttgggagggcattcactgctgttg
atcaaaatcaagcaaaagctggaagaacatttagccaagcagattgccatggttgatttg
ttcaaatataccaccgttgccagtctggcaaaatttctgagtcaagggaaaacaggtaca
gcttccttatcacgccaccaggcgcgtgcgcagcggcaacgtggcgctttcattcaacgg
aaacaagagaggatacagtaa

DBGET integrated database retrieval system