KEGG   Nitrosomonas communis: AAW31_13840Help
Entry
AAW31_13840       CDS       T03942                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
nco  Nitrosomonas communis
Pathway
nco00500  Starch and sucrose metabolism
nco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AAW31_13840
Enzymes [BR:nco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AAW31_13840
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     AAW31_13840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase hDGE_amylase Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: AKH38639
UniProt: A0A0F7KIF0
LinkDB All DBs
Position
3073729..3075393
Genome map
AA seq 554 aa AA seqDB search
MIEDLWYKNAVIYSLDLETFMDLDGDGVGDFNGLIRRLDYLQFLDVDAVWLAPFQPTPNR
DNGYDITDYFGVDPRLGSGGDFVEFMHQAEKRGIKVLIDLVVNHTSDEHPWFQDARDPES
SKRDWYVWSEKRPEDWNEGMVFPGRQEATWTYDKKAKAYYFHRFFKFQPDLNMDNPSVRQ
EIRRIIGFWLQLGVKGFRIDALPFMIESVEPGKQKKKRRYDYLTEFRTFMQWRSGDAIML
GEANVLPEESQRYFGDEGDRIHMMFNFYVNQHLFYALASGDVRPLAEAIEATSDMPETGQ
WAQFLRNHDELDLGRLTDEQRKHVFEQFGPEEHMQLFGRGIRRRLAPMLGDRRHEELAYS
AMFSLPGTPIIRYGDELGMGDDLDLEDRNAVRTPMQWADTLNGGFSTADDLVHPVISKGV
WSYEHINVAAQRRDSSSLLNWTAKMIRLRKECPEIGWGKCTILDTGSPHVLALRYDWRGN
TVIVMHNFDKIPHEITLEPGVEGGECLSNLLAEEEHESGEDGIHRMALEALDYRWFRVGG
LDYVINRGRTMIKK
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaagacctctggtataaaaatgcggtgatctacagtctcgatctcgagactttc
atggacctcgatggcgatggcgtcggcgacttcaacggattgatccggcggctcgattat
ctgcagtttcttgacgtcgatgccgtctggctggcccccttccagccgacaccgaatcga
gacaatgggtatgacatcaccgactacttcggtgtcgatccccgcctcggctccgggggc
gatttcgttgaattcatgcaccaggcggagaagcgcggcatcaaggtgctgatcgacctc
gttgtcaaccacacctcagacgagcacccgtggtttcaggacgcacgcgatccggaatca
tccaagcgcgactggtacgtctggtcggaaaagcggccggaggactggaacgagggaatg
gtatttcccggccggcaggaggccacctggacctacgacaagaaggcgaaggcatactac
ttccaccgcttcttcaaattccaacctgatctcaacatggacaatccgtccgtacgccag
gaaatccgccgcatcattggattctggctgcagctcggcgtaaaggggtttcgcatcgat
gcgctgccgttcatgattgagagtgtcgaacctggcaagcaaaagaaaaagcggaggtac
gactacctcaccgaattccggaccttcatgcagtggcgcagcggggatgccatcatgctg
ggggaagccaacgtgctgcctgaggagagccagaggtacttcggtgacgagggggaccgc
atccacatgatgttcaacttttacgtcaatcagcacctgttctacgcgctcgctagcggc
gacgtgaggccgctggccgaagcaattgaggcgacgtctgacatgccggagaccggccag
tgggcgcaattcctgcgcaaccacgatgagctcgatctcggcagactgacggatgagcag
cgtaagcatgtgtttgagcagttcgggccggaggagcacatgcagctattcggccgcggc
atccggcggcgtctggctccaatgctcggcgaccgacggcatgaggagttagcctacagc
gctatgttctcgctgcccggcacaccgataatccggtacggcgacgagctgggaatgggc
gacgacctcgatctcgaagaccgaaacgctgtacgtacacccatgcagtgggcggacacg
ctgaacggcgggttttccaccgccgacgatctcgtccatccagtcatcagcaagggggtt
tggagctacgagcacatcaatgtagcagcgcaaaggcgcgattcgagctcgttgctgaac
tggacagcgaagatgatacgactccgcaaggaatgccccgagatcggatggggaaagtgc
acgatcctcgatactgggtcgcctcatgtattggccctgcgatatgactggcgcggcaat
acggtgattgtcatgcacaacttcgacaagatcccgcacgaaatcaccctcgagccaggt
gtagagggtggtgaatgcctgtcgaatctacttgccgaggaggagcacgaatccggcgag
gacggcatccaccggatggccctcgaagcgctcgactaccggtggtttcgtgtcggcgga
ttggattacgtcatcaaccgggggcgaacgatgataaaaaagtaa

DBGET integrated database retrieval system