KEGG   Nitrosomonas communis: AAW31_14360Help
Entry
AAW31_14360       CDS       T03942                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
nco  Nitrosomonas communis
Brite
Enzymes [BR:nco01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AAW31_14360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AKH38724
UniProt: A0A0F7KIK2
LinkDB All DBs
Position
3169168..3169809
Genome map
AA seq 213 aa AA seqDB search
MSTNLENFSKAAQSGNTYVLAPLPYADNALEPVISAHTMSFHYGKHHKAYVDNLNKLLAD
NNALAGQSLENIITATAGQADKAGIFNNAAQVWNHMFYWHSLSPEGGGEPPANLKQKIEA
SFGSVDACKKEFANAAVTQFGSGWAWLVQEGDKLAILKTSNADSPLTKNSRPLLTIDVWE
HAYYLDYQNRRPDYVNTILDKLINWEFAASNLR
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgagcactaatctggaaaatttttctaaagctgcacaatccggtaacacttatgtcctc
gctcccctcccctatgcagacaatgcactggaaccggttatttctgcccataccatgagc
ttccactatggcaagcatcacaaagcgtacgttgataatttgaacaaattgctagcagat
aataatgcattggctggacaatcactggaaaatatcatcactgccactgcaggtcaggca
gataaagcaggtattttcaataatgctgctcaagtctggaatcatatgttttattggcac
agtctcagccctgaaggtggtggcgagcctcctgcgaatttgaaacaaaaaattgaagcc
tcatttggtagcgtggacgcctgtaaaaaggaatttgccaatgccgccgtcacgcaattt
ggcagtggctgggcttggctggtgcaggaaggagacaaactggctattctcaaaacgagc
aatgcggattcgccgcttaccaaaaatagcagacctttgctgactattgatgtttgggag
catgcctattatctcgattatcaaaatcgccggcctgattatgtcaatacgattctcgat
aaactcatcaattgggaattcgctgcttcaaacctgcgttaa

DBGET integrated database retrieval system