KEGG   Nitrosomonas communis: AAW31_17400Help
Entry
AAW31_17400       CDS       T03942                                 

Definition
(GenBank) phosphoribosyl-ATP pyrophosphatase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
nco  Nitrosomonas communis
Pathway
nco00340  Histidine metabolism
nco01100  Metabolic pathways
nco01110  Biosynthesis of secondary metabolites
nco01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    AAW31_17400
Enzymes [BR:nco01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     AAW31_17400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH MazG TetR_C_20 MazG-like Bromo_coat
Motif
Other DBs
NCBI-ProteinID: AKH39190
UniProt: A0A0F7KFG4
LinkDB All DBs
Position
complement(3837586..3837915)
Genome map
AA seq 109 aa AA seqDB search
MTDSSILHRLAETIEARKTTDSSNSYVVKLLTSGQDKILKKIAEEAAETIMASKDENTAH
VVYEMADLWFHCLVLLAHHGLKPEDVLRELERREGISGIEEKLSRKTGQ
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgactgattcatctatacttcatcgtctggcagaaacgatcgaggcgcgtaaaacgact
gattcctccaattcttatgtggtaaaactgctcaccagtggtcaggataagatactcaaa
aaaattgccgaagaggctgcagaaacaatcatggcttcaaaggacgagaatacagcgcat
gttgtttatgaaatggcagatttgtggtttcattgtctagtattgctggcccatcacgga
ttaaaaccagaggatgtgctgcgcgaattagaacgacgagaaggtatttcgggtattgaa
gaaaaactatcgcgtaaaacaggtcaataa

DBGET integrated database retrieval system