KEGG   Neurospora crassa: NCU02133Help
Entry
NCU02133          CDS       T01034                                 

Gene name
sod-1
Definition
(RefSeq) superoxide dismutase-1
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ncr  Neurospora crassa
Pathway
ncr04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ncr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    NCU02133 (sod-1)
Enzymes [BR:ncr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     NCU02133 (sod-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 3880431
NCBI-ProteinID: XP_964291
UniProt: P07509
LinkDB All DBs
Position
I
AA seq 154 aa AA seqDB search
MVKAVAVVRGDSNVKGTVIFEQESESAPTTITYDISGNDPNAKRGFHIHTFGDNTNGCTS
AGPHFNPHGTTHGDRTAEVRHVGDLGNIETDAQGNAKGTVTDNLVKLIGPESVIGRTVVV
HAGTDDLGKGGNEESLKTGNAGPRPACGVIGISQ
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaggctgtcgctgtcgtccgtggtgactctaacgtcaagggcaccgtgatcttc
gagcaggagtccgagtccgctcccactaccatcacctacgacatctctggcaacgacccc
aacgccaagcgcggcttccacatccacaccttcggtgacaacaccaacggctgcacctct
gccggccctcacttcaacccccacggcaccacccacggtgaccgcaccgctgaggtccgc
cacgtcggtgatctcggcaacatcgagaccgatgcccagggcaacgccaagggcaccgtg
actgacaacctcgtcaagctcatcggccccgagagcgtcattggccgcactgttgtcgtc
cacgccggcactgacgaccttggcaagggtggcaacgaggagtccctcaagactggtaac
gccggtccccgccctgcctgcggcgtcattggtatctcccagtaa

DBGET integrated database retrieval system