KEGG   Neurospora crassa: NCU02542Help
Entry
NCU02542          CDS       T01034                                 

Gene name
emp-1
Definition
(RefSeq) embden-meyerhof pathway-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
ncr  Neurospora crassa
Pathway
ncr00010  Glycolysis / Gluconeogenesis
ncr00051  Fructose and mannose metabolism
ncr00052  Galactose metabolism
ncr00500  Starch and sucrose metabolism
ncr00520  Amino sugar and nucleotide sugar metabolism
ncr01100  Metabolic pathways
ncr01110  Biosynthesis of secondary metabolites
ncr01130  Biosynthesis of antibiotics
ncr01200  Carbon metabolism
Module
ncr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ncr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCU02542 (emp-1)
   00051 Fructose and mannose metabolism
    NCU02542 (emp-1)
   00052 Galactose metabolism
    NCU02542 (emp-1)
   00500 Starch and sucrose metabolism
    NCU02542 (emp-1)
   00520 Amino sugar and nucleotide sugar metabolism
    NCU02542 (emp-1)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    NCU02542 (emp-1)
Enzymes [BR:ncr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     NCU02542 (emp-1)
Membrane trafficking [BR:ncr04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    NCU02542 (emp-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 FGGY_N
Motif
Other DBs
NCBI-GeneID: 3881807
NCBI-ProteinID: XP_011392961
UniProt: V5IP39
LinkDB All DBs
Position
I
AA seq 489 aa AA seqDB search
MASGTLDNLPKDLRNEIEHLERLFTVDGAKLKEVTNHFVHELEKGLSVQGGSIPMNPTWV
MSFPDGNETGTYLALDMGGTNLRVCQVTLTETKSEFDIIQSKYRMPEELKTGDAEELWEY
IADCLMQFIETHHGDPTKLDALPLGFTFSYPATQNYIDEGILQRWTKGFDIAGVEGHNVV
PMFEAALQRRGVPIKLTALINDTTGTLIASAYTDPKMRIGCIFGTGCNAAYMENCGSIPK
LAHMNLPPDMPMAINCEWGAFDNEHKVLPRTPYDVIIDKDSPRPGQQSFEKMVAGLYLGE
IFRLVLVDLHDNQEIKIFPGQDIAKLRKAYSLDSSFLSLIEEDPFENLSETFELFQTKLG
LTPTGPELELIRRTAELIGTRAARLSACGVAAISKKKGYKQCHVGADGSVFNKYPNFKAR
GAQALREILDWPEKADPKEDDPIEILAAEDGSGVGAALIAALTMQRIKQGNMHGILHPEN
FRTTEPLPA
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcagggactctcgataaccttcctaaggatctccgcaatgagatcgagcacctc
gagcgcctctttaccgtcgatggcgccaagctcaaggaagttaccaaccacttcgtccat
gagctcgagaaaggccttagcgtccagggagggagcattcccatgaaccctacctgggtt
atgtccttccccgacggcaacgaaaccggtacttatctggctttggacatgggtggtaca
aacctacgtgtctgccaagtcactttgaccgaaacaaagtccgaattcgacatcatccag
tccaagtaccgcatgcccgaggagctcaagacgggcgacgccgaggagctgtgggagtac
attgccgactgcctcatgcaattcattgaaacgcaccacggagacccaaccaagctcgat
gcgcttccactcggttttactttctcctatccggcgacacagaactatatcgacgagggc
attctgcaacgctggacgaagggcttcgatatcgctggcgtagagggccataatgttgtc
cccatgtttgaggctgccctccagcgccggggagtgcctatcaagctgacggcgttgatc
aacgacactacaggcaccctgattgcctcggcatacactgatcctaagatgagaattgga
tgcatttttggcacaggttgcaatgctgcgtacatggagaactgtggctcgattcccaag
ctcgctcatatgaatctcccaccggatatgccaatggccatcaactgcgaatggggagct
tttgacaacgagcataaggtcttgcctcgtactccttacgatgtcattattgacaaggat
tcgccgcgtcccggtcagcagtccttcgagaagatggtcgcagggttgtatctgggtgaa
atcttccgcctggttttggttgacctccatgacaaccaggagatcaagatcttccctggc
caggatatcgccaagcttcggaaagcttatagtcttgactcgtccttcctttccctcatt
gaagaggatccgttcgagaacctttccgaaacctttgagctgtttcagaccaagctgggg
cttacacccaccggccccgaattggagctgattcgtcgcaccgccgagctaatcggtacc
cgcgccgctcgcctctccgcctgcggcgttgctgccatcagcaagaagaaaggatataag
cagtgccacgttggtgctgatggatccgttttcaacaagtatcccaacttcaaggctcgt
ggcgcgcaagcactccgtgagatcctggactggcctgagaaggcggaccccaaggaagat
gatccgattgagattctcgccgccgaggacggaagcggtgttggtgctgctttgatcgct
gccctgacgatgcaacggatcaagcaaggaaatatgcacggtatcctgcacccagagaac
ttcagaactaccgagcctcttcctgcgtga

DBGET integrated database retrieval system