KEGG   Neurospora crassa: NCU03857Help
Entry
NCU03857          CDS       T01034                                 

Gene name
tca-5
Definition
(RefSeq) tricarboxylic acid-5
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ncr  Neurospora crassa
Pathway
ncr00020  Citrate cycle (TCA cycle)
ncr00480  Glutathione metabolism
ncr01100  Metabolic pathways
ncr01110  Biosynthesis of secondary metabolites
ncr01130  Biosynthesis of antibiotics
ncr01200  Carbon metabolism
ncr01210  2-Oxocarboxylic acid metabolism
ncr01230  Biosynthesis of amino acids
ncr04146  Peroxisome
Module
ncr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ncr_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ncr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NCU03857 (tca-5)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NCU03857 (tca-5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    NCU03857 (tca-5)
Enzymes [BR:ncr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     NCU03857 (tca-5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 3871997
NCBI-ProteinID: XP_011394871
UniProt: V5ILI1
LinkDB All DBs
Position
Linkage Group VI; VI
AA seq 462 aa AA seqDB search
MSPVTANLIRSSLRQASVYSRLNIATAPAFTRPAAPSLFVSNNRFRTMASEAFQKIKVKN
PVVELDGDEMTRIIWQDIKEKFIYPFLDIDLKYYDLGLEYRDQTNDQVTIDAAEAIKKYS
VGVKCATITPDESRVEEFKLKQMWLSPNGTIRNALGGTVFREPIVIPRVPRLVPGWKKPI
IIGRHAFGDQYRAKDLVAPGPGKLQMVYTPEGGEPQVIDVFDYKNGGGVAQTQYNTDESI
EGFAHASFKLALDKGLPLYMSTKNTILKKYDGRFKDIFQQIYDTQYKEAFEAKKIWYEHR
LIDDMVAQMIKSSGGYIMALKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFESEAAH
GTVTRHYREHQKGNQTSTNPIASIFAWTRGLVQRGKLDNTPELIAFAEALEKACIDTVDI
DGIMTKDLALACGKTGREDWVTTSEYMAAVERRLKSTLKEKL
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcccgtcaccgcaaacctcatccgctcctccctccgtcaggcttctgtctactcc
cgtctcaacatcgccactgctcctgcctttactcgccctgctgccccttccctcttcgtc
tccaataacagattccgcacaatggcttccgaggctttccagaagatcaaggtcaagaac
cccgtcgtcgagctcgatggcgatgagatgacccgcatcatctggcaggacatcaaggag
aagttcatctaccccttccttgacatcgacctcaagtactatgacttgggtctcgagtac
cgtgaccagaccaacgaccaggtcactattgatgccgccgaggccatcaagaagtactcc
gtcggtgttaagtgtgctaccatcactcccgatgagtctcgtgtagaggagttcaagctc
aagcagatgtggctgtcccccaacggcaccatccgcaatgctctcggtggcactgttttc
cgtgagcccatcgtcattccccgcgtccctcgcctggtgcccggctggaagaagcccatc
attattggccgccacgcctttggtgaccagtaccgcgccaaggacctcgtcgctcccggc
cccggtaagctccagatggtttacacccctgagggtggtgagccccaggtcatcgacgtc
ttcgactacaagaacggcggcggtgttgcccagacccagtacaacactgatgagtccatc
gagggcttcgcccacgcttccttcaagctcgctcttgacaagggtcttcccctctacatg
agcaccaagaacaccatcctcaagaagtacgatggccgcttcaaggatatcttccaacag
atctacgatacccagtacaaggaggctttcgaggccaagaagatctggtacgagcaccgt
ctcatcgacgacatggtcgcccagatgatcaagagctccggtggctacatcatggccctc
aagaactatgatggtgatgtccagtccgatatcgttgctcagggcttcggctccctcggt
ctcatgacctccgtcctcatcacccccgatggtaagaccttcgagtccgaggctgcccac
ggtaccgtcactcgccactaccgcgagcaccagaagggtaaccagacctccaccaacccc
atcgcctccatctttgcctggacccgtggtcttgtccagcgtggcaagctcgacaacact
cccgagctcattgctttcgctgaggctctcgagaaggcctgcattgacaccgtcgatatc
gatggcatcatgaccaaggatctcgcgcttgcctgcggcaagaccggccgtgaggattgg
gtcaccacctccgagtacatggctgccgtcgagcgccgcctcaagagcactctcaaggag
aagctctaa

DBGET integrated database retrieval system