KEGG   Neurospora crassa: NCU03973Help
Entry
NCU03973          CDS       T01034                                 

Gene name
ala
Definition
(RefSeq) alanine
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
ncr  Neurospora crassa
Pathway
ncr00220  Arginine biosynthesis
ncr00250  Alanine, aspartate and glutamate metabolism
ncr01100  Metabolic pathways
ncr01200  Carbon metabolism
ncr01210  2-Oxocarboxylic acid metabolism
ncr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ncr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NCU03973 (ala)
   00220 Arginine biosynthesis
    NCU03973 (ala)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ncr01007]
    NCU03973 (ala)
Enzymes [BR:ncr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     NCU03973 (ala)
Amino acid related enzymes [BR:ncr01007]
 Aminotransferase (transaminase)
  Class I
   NCU03973 (ala)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-GeneID: 3873734
NCBI-ProteinID: XP_957612
UniProt: Q7RZ96
LinkDB All DBs
Position
Linkage Group VI; VI
AA seq 566 aa AA seqDB search
MAAGLSNALKTARHRLPSAAVRNYSIPVQQSAWGPATCGASGLDSSSGRAAPLFKSHNTP
PVIHSFTQQTRFQSFTQIRKMSSSNSRRLNIDNINPHVRAAKYAVRGELAVKSEEFRAAL
LRGTSDIPFSQVISANIGNPQQLDQKPITFFRQVLSLLENPLLLEHEDVLINHLGYKTDV
IERAKWFLKNVGSVGAYSASNGAPAIRQHIAEFLERRDGFPANWQDIYLSAGASSGVNTL
LHIICADEKSGILVPIPQYPLYTASLSILNATCVPYLLDESKNWGTDINTIKESYQKAKD
AGVDTRAIVIINPGNPTGASLSEEDIRAVLEFARQERLVVLADEVYQTNVFIGEFISFKR
VLRQLQKENPDGKYDCVELASLHSISKGMVGECGHRGGYFELVNFDPEVQAEIYKFVSIM
LCAPVIGQCLVELMVNPPKPGEPSYELYEKEYRGIYEGMRERANALHKAFEQMEGVECGA
PQGAMYLFPTINLPPKAAEAAAKEGRTPDEFYCMKLLEATGVCVVPGSGFGQKEGSLHFR
TTFLAPGTEWVGSIVKFHKEFMDQYR
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atggctgccggactgtcaaacgccctcaagaccgcccgtcaccggctgccgagcgcggcc
gtgagaaattattcaatccctgttcagcagtcggcgtggggtccggcgacatgcggagct
tccggccttgactcctcctcgggacgcgctgccccgctgttcaagtctcataataccccg
ccggttattcactcgttcactcagcaaactcggttccagtccttcacccagattcgcaaa
atgtcgtcctccaactcccgccgtctcaacattgacaacatcaacccgcacgttagagcg
gccaagtacgctgtgcgcggtgagcttgccgtcaagtccgaggagttccgggccgccctc
ctccgtggaacctccgacatccccttcagccaggtcatctcggccaacatcggcaacccc
cagcagcttgaccagaagcccatcacctttttccgccaggtcctcagtctcctcgagaac
cctctgcttctcgagcatgaggacgtcctcatcaaccacctcggctacaagactgatgtc
attgagcgcgccaagtggttcctcaagaatgttggctccgtaggagcttacagtgccagc
aacggcgcccctgccatcagacagcacattgcagagttcctcgagaggcgcgatggcttc
cctgccaactggcaagacatctacctctctgccggtgcttcttcgggagtcaacaccctc
ctgcacatcatctgcgccgatgagaagagcggcatcctggttcccatcccccagtaccct
ctctacaccgcctcgctctccatcctgaacgccacctgcgttccctacctcctcgatgag
tccaagaactggggcaccgacatcaacaccatcaaggagtcgtaccaaaaggccaaggac
gccggcgtcgacactcgcgccatcgtcatcatcaaccccggcaaccccaccggcgcctcc
ctctccgaggaggacatccgcgccgtcctcgagttcgcgcgccaggagcgccttgtcgtc
ctcgccgacgaagtctaccagaccaacgtcttcatcggcgagttcatctcgttcaagcgc
gtgctccgccagttgcagaaggagaaccccgacggcaagtacgactgcgtcgagctggct
tccctccactccatttccaagggcatggtgggcgagtgcggccaccgcggtggctacttt
gagctggtcaactttgatcccgaagtccaggctgaaatctacaagttcgtcagcatcatg
ctctgcgcgcctgtcattggccagtgcctggtcgagctgatggtcaatccgcccaagccc
ggcgagccctcctacgagctctacgagaaggagtaccgcggcatctacgagggcatgagg
gagcgcgccaacgctctccacaaggcgtttgagcagatggagggcgtcgagtgcggtgct
ccccagggtgccatgtacctcttccctaccatcaacttgccccccaaggccgccgaggcc
gccgccaaggagggccgtacccccgacgagttctactgcatgaagctcctcgaggctacc
ggcgtctgcgttgttcctggttctgggttcggtcagaaggagggtagcttgcacttccgc
actaccttccttgctcctggtaccgagtgggttggcagcattgtcaagttccacaaggag
ttcatggatcaatatcgttga

DBGET integrated database retrieval system