KEGG   Neurospora crassa: NCU04173Help
Entry
NCU04173          CDS       T01034                                 

Gene name
act
Definition
(RefSeq) actin
  KO
K05692  actin beta/gamma 1
Organism
ncr  Neurospora crassa
Pathway
ncr04145  Phagosome
Brite
KEGG Orthology (KO) [BR:ncr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    NCU04173 (act)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ncr03021]
    NCU04173 (act)
   03019 Messenger RNA biogenesis [BR:ncr03019]
    NCU04173 (act)
   03036 Chromosome and associated proteins [BR:ncr03036]
    NCU04173 (act)
   03029 Mitochondrial biogenesis [BR:ncr03029]
    NCU04173 (act)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ncr04812]
    NCU04173 (act)
   04147 Exosome [BR:ncr04147]
    NCU04173 (act)
Transcription machinery [BR:ncr03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     NCU04173 (act)
Messenger RNA biogenesis [BR:ncr03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     NCU04173 (act)
Chromosome and associated proteins [BR:ncr03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     NCU04173 (act)
    NuA4 complex
     NCU04173 (act)
  Chromatin remodeling factors
   BAF complex
    NCU04173 (act)
   PBAF complex
    NCU04173 (act)
   SWR1 complex
    NCU04173 (act)
Mitochondrial biogenesis [BR:ncr03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    NCU04173 (act)
Cytoskeleton proteins [BR:ncr04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     NCU04173 (act)
Exosome [BR:ncr04147]
 Exosomal proteins
  Proteins found in most exosomes
   NCU04173 (act)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 3877297
NCBI-ProteinID: XP_011394625
UniProt: P78711
LinkDB All DBs
Position
Linkage Group V; V
AA seq 375 aa AA seqDB search
MEEEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHHGIMIGMGQKDSYVGDEAQS
KRGILTLRYPIEHGVVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPINPKSNREKMT
QIVFETFNAPAFYVSIQAVLSLYASGRTTGIVLDSGDGVTHVVPIYEGFALPHAIARVDM
AGRDLTDYLMKILAERGYTFSTTAEREIVRDIKEKLCYVALDFEQEIQTAAQSSSLEKSY
ELPDGQVITIGNERFRAPEALFQPSVLGLESGGIHVTTFNSIMKCDVDVRKDLYGNIVMS
GGTTMYPGLSDRMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagaagttgccgccctcgtcatcgacaatggttcgggtatgtgcaaggccggt
ttcgccggtgatgacgcccccagagctgttttcccttccatcgtcggtcgtccccgtcat
catggtatcatgatcggtatgggccagaaggactcgtatgtcggtgatgaggctcagtcc
aagcgtggtatccttactctcaggtaccccatcgagcacggtgtcgttaccaactgggac
gacatggagaagatttggcatcacaccttctacaacgagctccgtgtcgcccccgaggag
caccccgtccttcttaccgaggctcccatcaaccccaagtccaaccgtgagaagatgaca
cagatcgttttcgagactttcaacgcccccgccttctacgtctccatccaggccgtcctt
tctctctacgcctccggtcgtaccaccggtatcgtcctcgactccggtgacggtgtcact
cacgtcgtccccatctacgagggtttcgcccttccccacgccattgcccgtgttgacatg
gctggccgtgatcttaccgactacctcatgaagattctcgctgagcgtggttacaccttc
tccaccaccgccgagcgcgaaatcgttcgtgacatcaaggagaagctctgctacgtcgct
ctcgacttcgagcaggagattcagaccgctgcccagagctcttctctcgagaagtcctac
gagcttcccgacggtcaggtcatcaccatcggcaacgagcgtttccgtgcccctgaggct
ctcttccagccttccgtccttggtctcgaatctggcggcatccacgtcaccactttcaac
tccatcatgaagtgcgatgtcgacgtcaggaaggatctctatggcaacattgtcatgtct
ggtggtaccaccatgtaccctggtctctccgaccgtatgcagaaggagatcactgctctt
gctccttcttccatgaaggtcaagatcattgctcctcccgagcgcaagtactccgtctgg
atcggtggttccattctcgcctcgctctcgaccttccagcagatgtggatctccaagcag
gagtacgacgagagcggtccctcgatcgtgcaccgcaagtgcttctaa

DBGET integrated database retrieval system