KEGG   Neurospora crassa: NCU04265Help
Entry
NCU04265          CDS       T01034                                 

Gene name
inv
Definition
(RefSeq) invertase
Organism
ncr  Neurospora crassa
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF4975
Motif
Other DBs
NCBI-GeneID: 3877388
NCBI-ProteinID: XP_961256
UniProt: Q1K7I2
LinkDB All DBs
Position
Linkage Group V; V
AA seq 695 aa AA seqDB search
MTKTTPYKNALVGLLSLASVLPDGTTASVLPRTQECQRQQYPGPKNPSFETGDLSGWTVV
NGTAFGKSSVTTAASSQLGSGPFNQVGKQFLSTNLQDGEAATGTLRSSTFKASSVMSFLI
GGNYDPANLYVGLVLEKDGSLLFSQTATNDEALIRIVWDTSAYAGQNVYLVVVDTSTTGH
ISLDDVRTGCDALKDGPHTFNILGQSNQPTSKNLTALSAASRYAVDPTRPQYHYTPYQGW
INDPAGLIQWGGKYHLFNQYNPVAPLWGPMYWSHAESTDAVHWRDLPVALTPPYVNNTQD
TSGRYTGSAVKNQDTGALQLIYTDATNVTYHPHAVPEVVSSAVSSDGIHFDLYSGNPIVA
EAPPTSSAGFRDPKVFWDPTANNWKMVVGSGDGHTGNVQLYKSTGPSSSELLSWEYVGVL
HQGDGSRGIMWECPNFFPIDDKWVLFYGQDKGFKGWYEVGSFNGTTFVSEKLGLFDSGPD
SYATQWFVDDAGRNLAVTWINNWNTTKWPSRVNGWAGTQSIMRELFIREDGGLGQKPVEE
VSLLASGPAKSLGQTDVFGTYEVGFTDTARLQATVDLAASDAPAFTIELFASGAESTSLV
YNFANRSLTIDTMNAGYGQAGTWEATIAKPADNRLSLDILIDRSSIEVFVGDGTAMTVRV
FPRYQESKNIRITSDGGKKTVFDDIVLTPMGSAWE
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaacaacgccatacaaaaacgcccttgttggcttgctgtcgttagcctcggtc
ctccctgatggtaccacggcttccgtcctgcctcgtacacaagaatgccaaaggcagcaa
tacccaggccccaagaaccccagcttcgaaactggcgatctgtcgggctggacagtcgtt
aatggaacagcctttggcaaatcctctgtcaccacagctgcctcctcgcagctagggagc
ggcccgttcaaccaagtcggcaagcagttcctctcaacaaatctgcaagatggcgaagct
gccactgggacactccgctccagcaccttcaaggcaagctccgtcatgagtttcctgatc
ggcggcaactatgatcccgccaatctctacgtgggacttgtcctggagaaagacggctcc
ctcttgttcagccagaccgccaccaacgacgaggccctcatccgcatcgtctgggacacc
agtgcctacgccggccagaacgtctacttggttgtggtcgataccagcaccactggccac
atcagcttggacgacgtccgaaccggctgcgacgccctcaaggacggccctcacactttc
aacatccttggccagagcaatcagcccacctccaagaacctgaccgctctctcagcggct
tcccgctacgcagttgacccgacccgtccccaatatcactacactccctaccagggctgg
atcaacgaccctgccggcctgatccagtggggcggcaaataccacctcttcaaccagtac
aaccccgtcgcccctctttggggtcccatgtactggtcgcacgccgagagcactgacgcc
gtacactggagggacctgcccgttgccttgaccccgccgtatgtcaacaacacgcaggac
accagcgggcgctacaccggcagcgccgtcaagaaccaagacacgggtgcgctgcaactc
atctacaccgacgccaccaacgtcacctaccacccgcacgccgtgcccgaagtcgtctcc
tcggccgtcagctccgacggcatccacttcgacctctacagcggcaaccccatcgtggcc
gaggcgcctcccacctcttccgccggattccgtgaccccaaggtcttctgggaccccacc
gccaacaactggaagatggtcgtcggttccggcgacggccacaccggcaacgtccagctg
tacaagtccaccggcccatcctcctccgagctcctctcctgggagtacgtcggcgtgctg
caccaaggcgacggcagccggggcatcatgtgggagtgccccaacttcttccccattgac
gacaagtgggttctcttctacggccaagacaaggggttcaaggggtggtacgaagtcggc
tccttcaacggcaccacttttgtttccgagaagctgggcctgttcgactctggccccgac
agctacgcgacgcagtggttcgtcgacgacgccggccgcaacctggccgtcacgtggatc
aacaactggaacacgaccaagtggcctagcagggtcaacggctgggccggcacgcagtcc
atcatgcgcgagctcttcatccgtgaagacggcgggctcggccagaagcccgtcgaggaa
gtgtccctcttggcgagcggccctgccaagtcgcttggtcagacggacgtgtttggaacc
tacgaggttggattcaccgacacggcgcgtctgcaggctactgtcgacttggccgctagc
gatgcgccggccttcaccattgagctgtttgcttccggtgccgagtctacttcgcttgtg
tacaactttgccaaccggtcgttgaccattgacaccatgaacgccggatacggtcaggct
ggtacgtgggaggccaccattgctaagccggctgacaaccgtctgtcgctggatatcctg
attgatcgctcgagcatcgaggtgtttgtgggtgatggaaccgccatgactgtcagggtg
ttcccgcgctaccaggagtccaagaacattaggatcaccagcgatggaggcaagaagact
gtctttgatgatattgttctgacgcccatggggtctgcttgggaataa

DBGET integrated database retrieval system