KEGG   Neurospora crassa: NCU04674Help
Entry
NCU04674          CDS       T01034                                 

Gene name
gh31-3
Definition
(RefSeq) glycosylhydrolase family 31-3
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
ncr  Neurospora crassa
Pathway
ncr00052  Galactose metabolism
ncr00500  Starch and sucrose metabolism
ncr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    NCU04674 (gh31-3)
   00500 Starch and sucrose metabolism
    NCU04674 (gh31-3)
Enzymes [BR:ncr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     NCU04674 (gh31-3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 3875364
NCBI-ProteinID: XP_959217
UniProt: F5HHN2
LinkDB All DBs
Position
Linkage Group V; V
AA seq 928 aa AA seqDB search
MFAGSRLAALGLLASVCSAALPQASRAINNNSLAKCPGYKATNVKTNANGLTAELKLAGK
ACNTYGTDLDNLVLEVTYETDNRLHVKIQDATNDVYQIPESIFPRPQAAQGANSKKSALK
FTYKTSPFSFAVTRAKTGEVLFDTSAASLVFESQYLRLRTKLPNNPNLYGLGEHSDSFRL
NTTNYIRTFWSQDAYSTPNGANLYGNHPVYYEHRKSGSHGVLFLNSNGMDVVIDKDSRSG
QYLEYNSLGGVVDFYFVAGPSPIEVAKQYAEITKLPAMMPYWGFGLHQCRYGYQDAFEVA
EVVYNYSKASIPLETMWTDIDYMDRRRVFTLDPQRFPLSTMRQLIGHLHENDQKYIVMVD
PAVSAAEGPENPALTKGIEENVFLKRNDSSIYKGVVWPGVSVFPDWFSANISRYWDSQFT
EFFSASSGINIDGLWIDMNEPSNFPCFFPCNDPEKSAIGYPPEPPAVRTPPRELPGWPCV
FQPEGTECKEKKDLTIEAPVKSDILIAKREETVEASITAGKQLGLPGRDLLFPKYSIHNK
AAYMDSWNADKGGLSNKTVNTDTIHQNGLAEYDVHNLYGTMMSIQSRGAMLARRPGLRPF
IITRSTFAGAGHSVGKWLGDNIADWQHYRESIYGMMAFASIYQIPMVGADVCGFGGNTTE
SLCARWAMLGAFSPFYRNHNEYLPSISQEFYRWEIVAEAARKAIDIRYRLLDYIYTAQYK
QSVDGTPMINPMFYLYPNDANTFGLQHQYFYGPGLLVAPVTEENSTSVDVYLPNDIFYDW
YTLDVVHGKGRTVTVKDQSLTDIPLYLRGGVIVPLRAKSAMTTTELRKQDFELIIAVGKD
LTAEGELYLDDGVSLEQQGVTNIKFKYALGVLTVNGDFGFKTDVKITNITVVGALGKKSV
DVNIPLTQACTAVLCEGTGGIVKKMCYE
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcaggatctcgtctcgcggccctcgggctgctggcttcagtctgctctgccgcc
cttccacaggccagtcgcgccatcaacaacaactcgttggccaagtgtcccggctacaag
gctacgaacgtcaagacgaacgccaatggcttgacggcggagctcaagcttgccgggaag
gcatgcaatacctacggcactgacctggataacctcgtccttgaggtgacatacgagaca
gacaaccgcctgcacgtcaagatccaagatgccacgaacgatgtgtatcagatccctgaa
tctatcttccctcgcccgcaggcagctcagggtgcgaactccaagaagtccgccctgaag
ttcacctacaagaccagccctttctccttcgccgtcactcgcgccaagacgggtgaggtt
ctcttcgatacttcagccgcttccctggttttcgagtcccagtacctgcgtcttcgtacc
aagctgcccaacaacccaaacctctacggtcttggtgagcattcggactctttccgcctc
aacaccaccaactacatccggactttctggtctcaggatgcctactccacccccaacgga
gcgaacctttacggcaatcacccggtctactacgagcaccgcaagagtggcagccacggt
gtcttgttcctcaactccaatggtatggacgtcgtcattgacaaggacagccgctccggt
caatacctcgagtacaactcccttgggggtgtcgttgacttctacttcgttgctggccct
agcccgatcgaggttgctaagcaatatgccgagatcaccaagctccctgccatgatgcca
tactggggtttcggcttacaccagtgccgttacggctaccaggatgccttcgaggttgct
gaggtggtttataactacagcaaggccagcatcccgcttgaaactatgtggaccgatatc
gactacatggaccgcagaagggtctttactctggatcctcagcgtttccccctctcgacg
atgaggcagttgatcggccaccttcacgagaacgaccagaagtatattgttatggtcgac
cctgccgtgtcggcggcagaggggcctgaaaaccctgctttgacgaaaggcattgaagaa
aacgtcttcctcaagcgtaatgatagctccatctacaaaggtgtcgtgtggccaggtgtc
tcagtcttccccgactggttctcggccaacatatccaggtactgggacagccagttcact
gaattcttctctgcgagctctggtatcaacattgatggtctctggattgacatgaacgag
ccctccaactttccttgcttcttcccttgcaatgaccccgagaaatccgccatcggctac
ccgcctgagcctcctgccgtaaggacacctccccgggagctccctggatggccttgcgtc
ttccagcccgagggaactgaatgcaaggagaagaaagacttgaccattgaggctcctgtc
aagagtgacattcttattgccaagcgcgaggagactgtggaagctagcattactgctggc
aagcagcttggtctccctggccgtgacctcctcttccccaagtattcaattcacaacaag
gctgcttacatggattcatggaacgccgacaagggcggtctctccaacaagactgtgaac
accgataccatccaccagaatggcctggccgaatatgatgttcacaacctttacggcacc
atgatgtcgatccagtcccgcggggctatgcttgcccgccgccctggcctccgccccttc
atcatcacccgctccacttttgctggcgctggccactcggttggcaagtggctcggtgac
aacattgctgactggcaacactaccgtgagagcatttacggaatgatggcgtttgcttcc
atctaccagatccccatggtgggcgctgatgtctgcggattcggcgggaacacaaccgag
tcgctctgcgctcgttgggccatgctgggtgccttctcccccttctaccgtaatcataac
gagtacctaccttccatcagccaggagttttaccgttgggagatcgtggctgaggccgcc
cgcaaggccatcgatatccgctatcgcctgctcgattacatctacactgcccaatacaag
cagtccgttgatggtactcccatgattaacccaatgttctacctctatcccaatgacgcg
aacacctttggcctccagcatcagtacttctacggtcccggtctccttgtagcccccgtc
actgaggagaactcgaccagcgttgatgtctaccttcctaacgatattttttacgattgg
tacacccttgacgtcgttcatggcaaggggaggaccgtcactgtcaaggatcagagcttg
actgacatcccgctctacctccgcggtggcgtcatcgttcctcttcgggccaagtctgcc
atgaccaccaccgaacttcgcaagcaggactttgagctcatcatcgcggtcggtaaggac
cttactgccgagggtgagctttaccttgatgatggagtcagcttggagcaacagggtgtg
acaaacatcaagtttaagtatgccttgggtgttctgactgtcaatggcgactttggattc
aaaacggatgtgaagatcaccaacatcaccgtcgtcggcgccttggggaagaagagcgtg
gatgtcaacatcccattgacccaggcctgcacagctgttctctgtgagggtactggtggt
atagtgaaaaaaatgtgttatgaataa

DBGET integrated database retrieval system