KEGG   Neurospora crassa: NCU05425Help
Entry
NCU05425          CDS       T01034                                 

Gene name
tca-7
Definition
(RefSeq) tricarboxylic acid-7
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
ncr  Neurospora crassa
Pathway
ncr00020  Citrate cycle (TCA cycle)
ncr00310  Lysine degradation
ncr00380  Tryptophan metabolism
ncr01100  Metabolic pathways
ncr01110  Biosynthesis of secondary metabolites
ncr01130  Biosynthesis of antibiotics
ncr01200  Carbon metabolism
Module
ncr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ncr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NCU05425 (tca-7)
  Amino acid metabolism
   00310 Lysine degradation
    NCU05425 (tca-7)
   00380 Tryptophan metabolism
    NCU05425 (tca-7)
Enzymes [BR:ncr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     NCU05425 (tca-7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N Imm52
Motif
Other DBs
NCBI-GeneID: 3879396
NCBI-ProteinID: XP_963248
UniProt: Q7SC30
LinkDB All DBs
Position
Linkage Group II; II
AA seq 1194 aa AA seqDB search
MHSSTAGRQHSLALAVCTDRSTDRPTPVSGRSNSTHLHGGQSEALFFRRCIPAAPSPDTN
ETSKTPTSVVPLPSKSRSSRLLSPSLPIPPLKSRRRRPRPRLTPPLLLPFAHPPPPNLPS
SRLYTQNKTPLLGLRFRFLRPNTLTSQQPPIMLRGSIRALQTAGASKRCYSQVAQTTRAS
LKPAVGRRPLAVSQQRRHESALHSPPDPNDNFLSGSAANYIDEMYLQWKQDPKSVHVSWQ
VYFKNMESGNMPISQAFQPPPSLVPGAANVVPGLAAGAGVGIGEGANVTNHLKVQLLVRA
YQARGHHKANIDPLGIRNTPASKGFGNIRPKELTPEYYGFTEKDLDTEYSLGPGILPRFA
RDGREKMTLREIIDACEKIYCGSYGVEFIHIPDREKCDWLRERLEIPQPFKYSIDEKRRI
LDRLIWSSSFESFLATKYPNDKRFGLEGCETLVPGMKALIDRSVDYGVKDIVIGMPHRGR
LNVLSNVVRKPNEAIFSEFAGMAGADEEGSGDVKYHLGMNFERPTPSGKRVQLSLVANPS
HLEAEDPVVLGKVRAIQHYNNDESDHKSAMGVLLHGDAAIAGQGIVYECLGFHNLPAFST
GGTIHLVVNNQIGFTTDPRFARSTAYCTDIAKAIDAPVFHVNADDVEAVNFVCQLASDWR
AEFKQDVIIDLVCYRKHGHNETDQPAFTQPLMYKRISEKSPQIDIYVDQLLKEGTFTKED
IEEHKQWVWGMLEESFSKSKDYQPTSKEWTTSAWNNFKSPKELASEVLPHMPTAVDKPTL
EHIGTVIGSTPEGFHAHRNLKRILTNRTKSVVEGKGIDWATAEALAFGTLVKEGHHVRIT
GQDVERGTFSQRHAVFHDQETEDTYIPLQHISEDQAPFVISNSSLSEYGILGFEYGYSLQ
DPNGFNMWEAQFGDFANTAQVIIDQFLASGESKWMQRTGLVMSLPHGYDGQGPEHSSARM
ERFLSLCNEDPRIYPSPEKLERQHQDCNMQIAYMTSPANLFHILRRQLKRQFRKPLVIFF
SKALLRHPVARSDIEEFTDDAHFRWILPDSAHQTGEIKAPEEIERVILCTGQVYAALLKH
RQDNKIDNVAITRIEQLHPFPWEQLRENLDQYTNAKTIVWAQEEPLNAGAWSYTQPRLET
LLNHTKHHDRKHVMYAGRAPSASVATGKKSSHVKEEKELVDMAFSVTQSKLKGE
NT seq 3585 nt NT seq  +upstreamnt  +downstreamnt
atgcacagcagcacagctggacggcagcactcgctcgctcttgcagtttgcaccgacagg
tcgaccgaccgcccgactccagtgagtggacggagcaactcgacgcacctgcacggcggg
cagagtgaggccctttttttccgtcgctgcattcccgccgccccttcccccgacaccaac
gaaacatcaaaaacaccaacgtctgtcgtccccctcccctccaaatctcgatcctctcgt
cttctctccccctctctccccattccccccctcaagagtcgacgacgacgaccgagacct
agacttactccgccgctccttttgccttttgcgcatcccccccccccaaatctcccctct
tccagattgtacacacaaaacaaaaccccgctgcttggattgcgctttcggtttctgcgt
cctaataccctcacctcacaacagccacccatcatgttgcgcggttccatccgggccctg
cagaccgcaggcgcctcaaaacgatgctattcccaggtcgcccagaccaccagggcctcc
ctcaagcccgccgttggccgccgtcccctggccgtctcccagcagaggcgccatgagagc
gccctccacagcccgcccgaccccaacgacaacttcctctcgggcagcgccgccaactat
atcgacgagatgtacctccagtggaagcaggaccccaagagcgtccacgtctcgtggcag
gtctacttcaagaacatggagagcggcaacatgcccatctcccaggccttccagcctcct
cccagcctggttcccggtgccgccaacgtggtgcccggtctcgctgccggcgccggcgtc
ggcattggcgagggtgccaacgtcaccaaccacttgaaggtccagctcctcgtccgcgcc
taccaggcccgtggtcaccacaaggccaacattgaccctctgggcatccgcaacactcct
gcctccaagggcttcggcaacatcaggcccaaggagctcacccccgaatactacggcttc
accgagaaggatctcgacaccgagtacagcctcggccccggcatcctcccccgtttcgcc
cgcgatggccgcgagaagatgacgctccgcgagatcatcgacgcctgcgagaagatctac
tgcggctcctatggtgtcgagttcatccacatccccgacagggagaagtgcgactggctc
cgtgagcgtctcgagatcccccagcctttcaagtactcgatcgatgagaagcgccgcatt
ctcgaccgcctcatctggtcctccagcttcgagtccttcctcgccaccaagtaccccaac
gacaagcgtttcggtctcgagggttgcgagacccttgttcctggtatgaaggccctcatc
gaccgctccgttgactacggcgtcaaggacatcgtcattggtatgccccatcgtggccgt
ctcaacgtcctctccaacgtcgtccgcaagcccaacgaggccatcttttccgaattcgcc
ggcatggccggtgccgatgaggagggttccggtgatgtcaagtaccacttgggtatgaac
ttcgagcgccctaccccctcgggcaagcgcgtccagctctccctcgttgccaacccctcg
catctcgaggctgaggaccccgtcgtcctcggcaaggtccgcgccatccagcactacaac
aacgacgagagtgaccacaagagcgccatgggtgtcctcctccacggtgatgccgccatc
gctggtcagggtatcgtctacgagtgcttgggcttccacaacctccccgccttctctacc
ggtggtaccatccacttggttgtcaacaaccagatcggtttcaccactgacccccgtttt
gcccgctccactgcctactgcacggatatcgccaaggccattgacgcccctgtcttccac
gtcaatgctgacgatgtcgaggctgtcaacttcgtctgccagctcgcttctgactggcgt
gccgagttcaagcaggatgttatcatcgaccttgtctgctaccgcaagcacggccacaac
gagaccgaccagcctgcctttactcagcccctcatgtacaagcgcatcagcgaaaagagc
cctcagatcgacatctacgttgaccagctcctcaaggagggcaccttcaccaaggaggac
atcgaggagcacaagcagtgggtctggggcatgctcgaggagagcttctccaagtccaag
gactaccagcccacttccaaggagtggaccaccagcgcctggaacaacttcaagagcccc
aaggagcttgctagcgaggttctcccccacatgcctaccgcggttgacaagccgaccctt
gagcacattggtaccgtcattggcagcactcccgagggcttccatgcccaccgtaacctg
aagcgtatcctgaccaaccgcaccaagtccgttgtggagggcaagggcatcgactgggct
accgctgaggctcttgcctttggtaccctcgtcaaggagggccaccacgtccgtatcacc
ggtcaggatgtcgagcgtggtaccttctctcagcgccacgccgtcttccacgaccaggag
actgaagacacctacattcctctccagcatatcagcgaggaccaggcccccttcgtcatc
tccaactcttccctctccgagtatggtatcctcggtttcgagtacggttactctctccag
gaccccaacggcttcaacatgtgggaggcccagttcggtgatttcgccaacactgctcag
gtcatcattgatcagttccttgcctctggtgagagcaagtggatgcagcgtaccggcctc
gtcatgtctctcccccacggttatgacggccagggtcccgagcactcttccgctcgtatg
gagcgtttcctctcgctttgcaacgaggatcctcgcatctacccctcccccgagaagctt
gaacgtcagcaccaggactgcaacatgcagattgcctacatgacctcccctgccaacctc
ttccacattctccgccgccagctgaagagacagttccgcaagcctctcgtcattttcttc
tccaaggcgctcttgcgtcaccccgttgctcgttccgacatcgaggagttcactgacgac
gcccacttccgctggatccttcccgactctgctcaccagactggtgagatcaaggcccct
gaggagattgagcgtgtcattctctgcactggtcaggtctatgccgctctcctcaagcac
cgccaggacaacaagatcgacaacgtcgccatcactcgtatcgagcagctccaccccttc
ccctgggagcagctccgtgagaacctcgaccagtacaccaacgccaagaccatcgtctgg
gcccaggaggagcccctcaacgctggtgcctggtcttacacccagcctcgtcttgagact
cttctcaaccacaccaagcaccatgaccgcaagcacgtcatgtacgctggtcgtgctccc
agcgcttctgtcgctactggcaagaagtcttctcacgtcaaggaggagaaggagcttgtc
gacatggctttctctgttactcagagcaagctcaagggcgagtaa

DBGET integrated database retrieval system