KEGG   Neurospora crassa: NCU05780Help
Entry
NCU05780          CDS       T01034                                 

Gene name
gst-1
Definition
(RefSeq) glutathione S-transferase-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ncr  Neurospora crassa
Pathway
ncr00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    NCU05780 (gst-1)
Enzymes [BR:ncr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     NCU05780 (gst-1)
Transporters [BR:ncr02000]
 Other Transporters
  Pores ion channels [TC:1]
   NCU05780 (gst-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_2 GST_C_3 Tom37
Motif
Other DBs
NCBI-GeneID: 3876187
NCBI-ProteinID: XP_960040
UniProt: Q7S5R3
LinkDB All DBs
Position
Linkage Group VII; VII
AA seq 236 aa AA seqDB search
MADSSSLKPIKVYGHTGPNPPKVIMVLAELGIPYDLDNIQISQAKSPEFVKNVNPNGRLP
AIQDPNTDLTLWESGAILEYLTEKYDKELKLSFTPGTNDFYLARQWLYFQTTGQGPYYGQ
VAWFKRYHPEPVPSAVERYVKELNRVSSVMEDHLQTQKEKYGTEEPWFVGNKFSYVDIAF
APWQHIVGVMLTKEEYDEDKYPLIHAWLERLRARKPIKDALDNMIPAGGPPPKQNE
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggcggactcttcctctctcaagcccatcaaggtctacggccacaccggccccaacccg
cccaaggtgatcatggtccttgccgagctcggcattccctatgacctggacaacatccaa
atctcccaggccaagagccccgagttcgtcaagaacgtcaaccccaacggccgcctgccc
gccatccaggaccccaacacggacctcaccctctgggagtccggtgcgatcctcgagtac
ctgaccgagaagtacgacaaggagctcaagctcagcttcacccccggcaccaacgacttc
tacctcgcccgccagtggctctacttccagaccacgggccagggcccctactacggccag
gtcgcgtggttcaagagataccacccggagccggtgcccagcgccgttgagagatatgtc
aaggagctgaaccgcgtgtcgagcgtgatggaggaccacttgcagacgcagaaggagaag
tacggcaccgaggagccgtggtttgtgggcaacaagttcagctacgtcgacattgcgttt
gcgccgtggcagcacattgtcggcgtgatgctgaccaaggaggagtatgatgaggacaag
tacccattgatccacgcctggttggagaggttgagggcgagaaagcccatcaaggacgct
ttggataacatgattcctgctggtggccctcctcctaagcagaacgagtaa

DBGET integrated database retrieval system