KEGG   Neurospora crassa: NCU06112Help
Entry
NCU06112          CDS       T01034                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ncr  Neurospora crassa
Pathway
ncr00250  Alanine, aspartate and glutamate metabolism
ncr00410  beta-Alanine metabolism
ncr00430  Taurine and hypotaurine metabolism
ncr00650  Butanoate metabolism
ncr01100  Metabolic pathways
ncr01110  Biosynthesis of secondary metabolites
Module
ncr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ncr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NCU06112
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NCU06112
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NCU06112
   00430 Taurine and hypotaurine metabolism
    NCU06112
Enzymes [BR:ncr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     NCU06112
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 3876112
NCBI-ProteinID: XP_959974
UniProt: Q7S5H6
LinkDB All DBs
Position
Linkage Group VII; VII
AA seq 545 aa AA seqDB search
MNGFHSTDKPLNRASEVDHLIDAVKSLIIPYIRDADNAASFRATGQLPPDNRNVLVKSLR
PDQLVKELALSLPSGEGQGSQGLLETIQSILSYSVNTWDQGFMDKLYASTNAVGVVTELL
LSVLNTNLHVYQVSPALSVIEKYTAKQFAALFGFTGPRAGGVTCQGGSASNLTSIVIARN
TLFPLSKLHGNGHEQCGAPGPLILLTSAHGHYSIEKAAMTCGFGSSAVWTVPVDEQGRMQ
PAALREMVLKAKSEGKHPFYVNATAGTTVLGSYDPFDEIADVCDEFGMWLHIDGSWGGPA
VFSKKHKHKMQGSHRARSLTVNPHKMLNAPVTCSFLLTNDVKVFHRANTLPAGYLFHGPA
AAEEEEDADGEENAPQSQTTPSEEGVTTTNGCGNGNTQDEVWDLADLTLQCGRRGDALKL
ALSWIYYGAAGFERQIDGAFDMAAYLANLIAERNDFVLVSSNPPPCLQVCFYYAPGGKLA
DEPQENTRRTRIMVEKLIARGFMVDYAPGDKGSLFRVVVNCQTLRGTVEGLVKGLEAIGK
EIVPQ
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgaacgggtttcacagcacggacaagcctctgaacagggcaagcgaggttgatcatctc
atcgatgcggtcaagtccctaatcatcccctacatccgggacgcagacaacgccgcctct
ttccgagccaccggccaactacccccagataaccgcaatgtccttgtcaaatccctccga
ccggaccaactcgtcaaggaactggcgctctccctcccttcaggcgagggccagggctcg
cagggtcttttagaaaccatccagtccatcctctcttactccgtcaacacgtgggaccaa
ggcttcatggacaagctgtacgcctccaccaacgccgtcggtgtcgtcactgagctgctc
ctctccgttctcaacaccaacctgcacgtctaccaggtatctcccgccctcagcgtgatc
gagaagtacacagccaagcagttcgccgcgctgttcggcttcaccggcccccgcgccgga
ggcgtcacctgccagggcggcagcgcttctaatctgacctccatcgtcattgcccgcaac
acgcttttcccactctccaagctccacggtaacgggcacgagcagtgcggcgccccgggc
ccgctgattcttctcaccagtgctcacgggcactactcgattgagaaagccgccatgacg
tgcggtttcgggtcctcggcggtctggaccgtccccgtcgatgagcaagggcgcatgcaa
cccgccgctttgcgcgagatggtcctcaaagccaagagcgagggaaaacaccccttttac
gtcaacgcgacggctggcacgacggtcttgggctcgtacgacccgtttgacgagatcgcg
gacgtgtgcgacgagtttggcatgtggttgcacattgatgggagctggggtggcccagcc
gtctttagcaagaaacacaagcacaagatgcaagggtcgcatagggcgaggtcactgacg
gtgaatccgcacaagatgctcaatgcccccgtgacgtgttcgttccttttgaccaatgat
gtcaaggttttccatagggcgaatacgttgccggctggctatctgttccatgggccggcg
gcggcggaggaggaggaggatgccgacggggaagagaatgcgccgcaaagccagaccacc
ccttcggaggaaggagtgactaccacaaacggatgtggaaacgggaacacccaagacgag
gtctgggatctagccgacctgacgctccagtgcggtcgcagaggcgacgcgctcaagctg
gctttgtcgtggatctactacggcgcagccgggttcgagcgccagattgacggcgccttc
gacatggccgcctacttggccaatctgattgccgagcgcaacgactttgtgctggtgtcg
tcgaacccgccgccttgtttgcaggtgtgcttttactatgcccccggcggcaagttggcg
gacgagcctcaagagaacaccagaaggacgagaatcatggtggagaagttgattgcgaga
gggttcatggtggattatgccccgggcgataagggaagcctctttagggtggtggtcaat
tgccagacgttgaggggaacggtggaggggctcgttaagggtttggaagctattggaaag
gagattgtgccgcaatga

DBGET integrated database retrieval system