KEGG   Neurospora crassa: NCU06471Help
Entry
NCU06471          CDS       T01034                                 

Gene name
pro-1
Definition
(RefSeq) proline-1
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
ncr  Neurospora crassa
Pathway
ncr00330  Arginine and proline metabolism
ncr01100  Metabolic pathways
ncr01110  Biosynthesis of secondary metabolites
ncr01130  Biosynthesis of antibiotics
ncr01230  Biosynthesis of amino acids
Module
ncr_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ncr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    NCU06471 (pro-1)
Enzymes [BR:ncr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     NCU06471 (pro-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P5CR_dimer F420_oxidored
Motif
Other DBs
NCBI-GeneID: 3873483
NCBI-ProteinID: XP_957362
UniProt: Q12641
LinkDB All DBs
Position
Linkage Group III; III
AA seq 332 aa AA seqDB search
MAAPQVKSSSELTMAVLGCGTMGISILSGILSSLSSIAQDPSPPPTNPPALPRHFIATVR
SPSSVAKVESALSPLVKPSVSTLRVLQSTSNVSAAAEADIILLGCKPYMVSGLLSASGMK
DALTVKHTEGHARSQKIIISICAGVTVPDLERVLREDVGLSADNLPIVVRAMPNTASKIR
ESMTVINTVDPPLPDTVTELLTWIFERIGEVVYLPPHLMDACTSLCASGTAFFALMMEAA
ADGGVAMGLPRAEANRMAAQTMRGAAGLVLEGEHPAILREKVSTPGGCTIGGLLVLEEGG
VRAAVARAVREATVVASLLGGGGAKNVNGTRH
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggctgctcctcaagtaaagagctcctccgagctcaccatggccgttctcggctgcgga
acgatgggcatctccatcctctccggcatcctctcctccctttcctccatcgcccaagac
ccctctccaccacccaccaacccccccgccctcccgcgccacttcatcgccaccgtgcgc
tccccatcctccgtcgccaaagtcgagtccgccctctccccgctcgtcaagccctccgtt
tctactctgcgcgtcctccaatccacctccaacgtctccgccgccgccgaagccgacatc
atcctcctcgggtgcaagccctacatggtctctggcctactttccgcatccggcatgaaa
gatgctctgacagtcaagcacaccgaaggccacgcgcggtcccaaaagatcatcatttcc
atctgcgcgggcgtgacggttccggacctggagcgggtcttgcgcgaggacgtcggactg
tccgctgataacttgccgattgtggtgcgcgcgatgcccaacacggccagcaagatcaga
gagagcatgacggttatcaacacggttgaccccccgctgccggataccgtcacggagctg
ctgacgtggatttttgagaggatcggcgaggtcgtgtatttgcctccgcacttgatggac
gcgtgcacttctttgtgtgcttcgggcacggcgttcttcgcgctgatgatggaggcggcg
gcggatggaggtgtggcgatggggttgcctagggcggaggcgaacaggatggcggcgcag
accatgaggggtgctgctgggctcgtgctggagggagagcatccggcgatcttgagggag
aaggtgagcacgccgggcgggtgcacgattggcgggttgttggtgttggaagagggtggg
gttagagcggcggttgcgagggcggttagggaggcgacggttgttgcgagcttgttggga
ggagggggagcgaagaatgtcaatggtactaggcattag

DBGET integrated database retrieval system