KEGG   Neurospora crassa: NCU06687Help
Entry
NCU06687          CDS       T01034                                 

Gene name
gsy-1
Definition
(RefSeq) glycogen synthase-1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
ncr  Neurospora crassa
Pathway
ncr00500  Starch and sucrose metabolism
ncr01100  Metabolic pathways
Module
ncr_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:ncr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NCU06687 (gsy-1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ncr01003]
    NCU06687 (gsy-1)
Enzymes [BR:ncr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     NCU06687 (gsy-1)
Glycosyltransferases [BR:ncr01003]
 Polysaccharide
  Storage polysaccharide
   NCU06687 (gsy-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glyco_transf_5 Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 3877149
NCBI-ProteinID: XP_011394695
UniProt: O93869
LinkDB All DBs
Position
Linkage Group V; V
AA seq 706 aa AA seqDB search
MAHDNREPREVKNHLLFEVATEVAHRVGGIYSVLKSKAPVTTAEYGDRYTLIGPLNHQSA
AVEVEELEPSNPELKATIQAMRDRGIGILYGRWLIEGAPRVLLFDTKTAYGYMNEWKTDL
WNVASIPSPDNDEETNEAIVFGYLVAWFLGEFVCHEKRKAVIAHFHEWLAGVALPLTKKR
QIDVTTIFTTHATLLGRYLCAGSVDFYNNLQWFDVDAEAGKRGIYHRYCIERAAAHSCDV
FTTVSHITAYESEHLLKRKPDGVLPNGLNVTKFSAMHEFQNLHQQNKEKIHDFVRGHFYG
HYDFEPENTLYFFTAGRYEFRNKGVDMFIESLARLNHRLKTAGSKTTVVAFIIMPAQTTS
LTVEALKGQAVIKSLRDTVDVIERGIGRRIFERSVKWHEGDPLPEEKELITSQDRVLLRR
RLFAMKRHTLPPIVTHNMLNDHEDPILNQIRRVQLFNHPSDRVKIVFHPEFLSSANPVLP
LDYDDFVRGTHLGVFASYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELIENSSDYGI
YIVDRRSKGVDDSVNQLTQYMFEFTQKSRRQRINQRNRTERLSDLLDWKRMGMEYVKARQ
LALRRAYPTSFNGEEEEDFIPGVEQKISRPFSVPGSPRDRTGMMTPGDFASLQESHEGLS
TEDYVAWKLPEEEDPEEYPFPLTLKQRTGPGSPLDSIQGLQLNGTR
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggcccacgacaaccgtgaaccccgcgaggtcaaaaaccacctcctctttgaggtggcg
accgaggtcgcccatcgagttggtggaatctactccgttctcaagtcgaaagctccagtt
acaaccgctgaatatggcgaccgttacactcttatcggtcctttgaaccaccaatcggcg
gccgtcgaggttgaagagctagagccatccaaccccgaactaaaggcgacgattcaggcc
atgagagaccgtggcatcggcattctttacggacgatggctcattgagggagctcccaga
gtgttgctcttcgatacaaagaccgcttacggttacatgaacgagtggaagacggacctc
tggaatgttgcttctatcccatctccggacaacgacgaagagacgaacgaggccattgtc
tttggttacctggtcgcatggttcctgggcgagtttgtatgccatgagaagagaaaggcc
gtcatcgcccacttccacgaatggcttgccggtgtcgcgctgccattgaccaagaagagg
cagattgacgttaccaccatcttcacgacacatgccactcttctcggtcgctatttgtgc
gccggctcagtagacttctacaacaaccttcagtggtttgacgttgacgccgaggctgga
aagcgtggaatctatcatagatactgcatcgagcgagctgccgcccattcctgcgatgtc
ttcaccaccgtttcccacattacagcttacgagagtgagcatttgctcaagcgcaagccc
gatggtgtcctccccaatggtctcaacgtcaccaagttctcggccatgcacgagttccag
aacctccaccagcaaaacaaggagaagattcatgactttgtccgcggtcacttctacggc
cattacgattttgagccagaaaacacgctctacttctttactgcgggtcgctacgagttc
aggaataagggtgtggacatgtttatcgagtcgcttgcccgtctcaaccaccgcctcaag
accgccggaagcaagacgacagttgttgctttcatcatcatgcctgcccagaccacttcc
ttgaccgttgaagcattgaagggacaggctgtcatcaagtctctgagagataccgttgat
gttattgagcgtggaattggccgtcgcatctttgagcgctctgtcaagtggcacgagggc
gacccgttgcctgaggagaaggagctgattaccagtcaggaccgtgttctccttcgtcgt
cgtctctttgccatgaagaggcacacactcccacccattgttacccacaacatgctcaac
gaccacgaggacccaattctgaaccagatccgccgggtacagctcttcaaccatccctca
gaccgagtcaagattgttttccatcccgagttcttgagctcggccaaccccgtgttgcct
ctcgattacgatgactttgtgcgcggcacccatctgggcgtcttcgcttcttactacgag
ccttggggctacactccggcagaatgcactgtgatgggtgtaccaagcatcaccaccaac
ctctctggattcggctgctacatggaggaactcatcgagaactcgagcgactacggtatc
tatatcgtggatcgtcgctccaagggagtcgatgactcggtcaaccagcttactcagtac
atgtttgaatttacccagaagagccgcagacagcgcatcaaccagagaaacagaaccgag
cgtttgagcgatctcttggactggaagcgaatgggtatggagtacgtcaaggcacgccaa
cttgcgttgcgccgcgcctatcctacatctttcaatggcgaggaggaggaagacttcatt
ccaggagtcgagcaaaagatatctcgtcccttctcagtaccgggctcgcctagagaccgg
actggtatgatgacccctggcgattttgctagtcttcaggagagtcacgagggtctgagt
accgaggactacgttgcatggaagttacctgaggaagaggaccctgaagagtatcctttc
ccgcttaccctgaagcagcgtacggggccgggtagccccctcgacagtattcagggtcta
caactcaacggcaccaggtaa

DBGET integrated database retrieval system