KEGG   Neurospora crassa: NCU07860Help
Entry
NCU07860          CDS       T01034                                 

Gene name
gh13-5
Definition
(RefSeq) glycosylhydrolase 13-5
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
ncr  Neurospora crassa
Pathway
ncr00052  Galactose metabolism
ncr00500  Starch and sucrose metabolism
ncr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    NCU07860 (gh13-5)
   00500 Starch and sucrose metabolism
    NCU07860 (gh13-5)
Enzymes [BR:ncr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     NCU07860 (gh13-5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 Glyco_hydro_42C
Motif
Other DBs
NCBI-GeneID: 3879260
NCBI-ProteinID: XP_963121
UniProt: Q7SBU9
LinkDB All DBs
Position
Linkage Group III; III
AA seq 486 aa AA seqDB search
MRLVLDLVVNHTSDQHAWFKESRSSKDNPKRDWYIWKPPRYAEDGTRLPPTNWRSYFSGS
AWEYDEHTNEYYLHLFAKEMPDLNWESEECRKAIYDSAMRFWLDKGVDGFRVDCVNMYSK
STEFLDAPIVDSRFYEQPAWCYYANGPRMHEFLREMNEKVLDRYDAMTVGELPHTPDPKR
VLDYVGRKDKQLSMVFQFDIVDIGQGGTHKYHFEEWKLPVLKKIVEKWQRFIEGTDGWTT
SFCENHDQGRSISRFASDAPEYRVLSGKMLSLMMCSLTGTLFIYQGQEIGMINVPKDWPI
DYYQDIESVNFYKLMAAKTNNDPEEMAYVMRSLQTLSRDNARIPMQWDDSPYAGFTERKE
GAWAHVHDLYPEINVAKQLDDPNSTLSFWKDMIRFRKQHSEVLVHGTFEACDIENEKTFV
FVKRFGGKRVVVTLNFSNEEQEVVLPEHEKGLKFMVGNYGNEEGGMGERRRLRPWEGRLY
MAGGEA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgagactggtcttggacctggttgtcaatcacacctctgatcagcatgcctggttcaag
gagtcgcgatcctccaaggacaatccgaagcgtgactggtacatctggaagcctcctcgt
tacgccgaagatggaacacgccttccaccgacgaactggcggagttacttctcaggcagt
gcgtgggagtatgacgaacatacaaacgaatattatcttcatctgtttgccaaggagatg
ccagacctcaactgggagagtgaagagtgccgcaaagccatttacgacagcgccatgcgc
ttctggttggataagggcgtggatggcttccgagttgactgtgtgaacatgtactcaaag
tccacagaatttctcgatgctcccatcgttgactcacgcttctacgagcagccggcatgg
tgctattatgccaacgggccacgcatgcacgagtttctgcgcgagatgaatgaaaaggtg
ctcgaccgctacgacgctatgaccgtcggcgagttaccgcacactcccgacccgaagagg
gtgctcgactatgttgggcgcaaagataagcagctcagcatggtgtttcagttcgacatt
gtggacatcggccaaggtggcacccacaagtaccattttgaggagtggaagttacctgtg
ctgaagaagattgtcgagaagtggcaacgcttcatcgagggcactgatggatggacaaca
tccttctgcgaaaaccacgaccaaggccgttccatttcacgcttcgcctccgacgccccc
gaataccgcgtcctctcgggcaagatgctctcgctgatgatgtgctctttgacgggaacc
ctcttcatctaccaaggccaagagatcggcatgatcaacgtgcccaaggactggcccatc
gactactaccaggacatcgagtcggtcaacttttacaagctgatggccgccaagaccaac
aacgaccccgaggagatggcgtacgtgatgcgcagcctccagactctgagtagagataac
gcccggatacctatgcagtgggatgacagtccgtatgctgggttcactgaaaggaaggaa
ggtgcctgggcgcacgtccacgacctgtatcccgagatcaacgtggccaagcaactcgac
gatccgaactcgacgctcagcttttggaaagacatgatccgtttccgcaagcaacatagc
gaggtactggtgcatggaacgttcgaggcgtgtgatatcgagaacgagaagacgtttgtg
ttcgtcaagagattcggaggtaaacgggttgtagttactctgaacttcagcaatgaagag
caggaggtggtgttgccggagcatgaaaaggggttgaagtttatggtcggaaactatggc
aacgaagaaggggggatgggcgaaaggagaaggttgaggccatgggagggaaggttgtac
atggctggaggtgaggcttga

DBGET integrated database retrieval system