KEGG   Neurospora crassa: NCU08336Help
Entry
NCU08336          CDS       T01034                                 

Gene name
tca-12
Definition
(RefSeq) tricarboxylic acid-12
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ncr  Neurospora crassa
Pathway
ncr00020  Citrate cycle (TCA cycle)
ncr00190  Oxidative phosphorylation
ncr01100  Metabolic pathways
ncr01110  Biosynthesis of secondary metabolites
ncr01130  Biosynthesis of antibiotics
ncr01200  Carbon metabolism
Module
ncr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ncr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ncr_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ncr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NCU08336 (tca-12)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NCU08336 (tca-12)
Enzymes [BR:ncr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     NCU08336 (tca-12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 5847357
NCBI-ProteinID: XP_001728186
UniProt: A7UWT5
LinkDB All DBs
Position
I
AA seq 648 aa AA seqDB search
MSSLAWRKLAAAPTLARAASRVQNRAFSSTRPAARVIAPGPLRAKEASPHLSSKYHVIDH
EYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHEDDWR
WHMYDTVKGSDWLGDQDAIHYMTREAPASIVELENYGCPFSRTEDGKIYQRAFGGQSKEF
GKGGQAYRCCAAADRTGHALLHTLYGQSLRHNTNYFIEYFAVDLIMQDGECRGVLAYNQE
DGTLHRFLANNTVLATGGYGRAYFSCTSAHTCTGDGSAMVARAGLPNQDLEFVQFHPTGI
YGAGCLITEGARGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPE
KDHIYLQLSHLPAEILAERLPGISETAGIFAGVDVRKQPIPVLPTVHYNMGGIPTRYTGE
VLTVDEQGNDKVVPGLFACGEAASVSVHGANRLGANSLLDLVVFGRAVSHTIRDKFTPGS
KLKPIEADAGSESIEVLDKIRTSDGPKSTAEIRLAMQKTMQRDVSVFRTQESLDEGVEKI
TQVDQMFDQVGIKDRSMIWNSDLVETLELRNLLTCATQTAVSAANRKESRGAHAREDYPE
RDDKNWMKHTLSWQKQPHGKIELGYRRVIDTTLDEKECPPVPPFKRVY
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctttggcttggagaaagttggctgcggcgcccacgctcgcgcgtgccgccagc
agagtccagaacagagccttttcctcgacaaggccggccgcccgcgtcatcgctcccggt
cctctccgtgctaaggaggcttctccccatctcagcagcaagtaccatgtcatcgaccac
gagtacgatgccatcgttgtcggtgccggcggtgccggtctccgtgccgctttcggtctc
gccgaggccggcttcaacaccgcctgcatttccaagctcttccccaccagatctcacacc
gtcgctgcccagggcggtatcaacgctgcgctcggcaacatgcacgaggatgactggagg
tggcacatgtacgacaccgtcaagggctccgactggctcggtgaccaggatgctattcac
tacatgacccgcgaggctcccgcctccattgtcgagctcgagaactacggctgccccttc
tcccgtaccgaggacggcaagatctaccagcgtgctttcggtggtcagtccaaggagttc
ggcaagggtggccaggcctaccgctgctgcgctgctgccgatcgtaccggccacgctctt
ctccacaccctctacggccagtctctccgccacaacaccaactacttcatcgagtacttc
gccgttgacctgatcatgcaggatggcgagtgccgtggtgtcctcgcctacaaccaggag
gacggcactctccaccgcttcctcgccaacaacaccgtcctcgccaccggtggatacgga
cgcgcctacttctcctgcacttccgcccacacctgcaccggtgacggttccgccatggtt
gcccgtgccggtctccctaaccaggatctcgagttcgtccagttccaccctaccggtatc
tacggcgccggctgcttgattaccgagggtgctcgtggtgagggtggttacctcctcaac
tctgagggtgagcgtttcatggagcgttatgcccctaccgccaaggatctcgcctcccgt
gatgtcgtttcccgctccatgaccatggagatccgcgagggccgtggtgtcggccctgag
aaggaccacatctacctccagctcagccatctccccgccgagattctcgccgagcgtctc
cccggtatctctgagaccgccggtatcttcgctggtgtcgatgtccgcaagcagcccatc
cccgtccttcccaccgttcactacaacatgggtggtatccccactcgctacactggtgag
gttcttaccgtcgatgagcagggcaacgacaaggttgtccctggtctcttcgcttgcggt
gaggctgcttccgtctctgtccacggtgctaaccgccttggtgccaactctcttctcgac
ttggtcgtcttcggccgtgccgtctcccacaccatccgtgacaagttcactcctggctcc
aagctgaagcccattgaggccgatgccggttccgagtccatcgaggtcctcgacaagatc
cgcacttccgacggccccaagagcaccgccgagatccgcctcgccatgcagaagaccatg
cagcgcgacgtctccgtcttccgtacccaggagtcccttgatgagggtgttgagaagatc
acccaggtcgaccagatgttcgaccaggtcggcatcaaggaccgctccatgatctggaac
tctgatctcgtcgagacccttgagctccgcaacttgctcacttgcgccacccagaccgcc
gtctccgccgccaaccgcaaggaatctcgtggtgcccacgcccgtgaggattaccccgag
cgtgacgacaagaactggatgaagcacaccctctcttggcagaagcagccccacggcaag
atcgagctcggttaccgccgtgtcattgacacgacccttgacgagaaggagtgccctcct
gttcctcctttcaagcgtgtctactaa

DBGET integrated database retrieval system