KEGG   Neurospora crassa: NCU08998Help
Entry
NCU08998          CDS       T01034                                 

Definition
(RefSeq) 4-aminobutyrate aminotransferase
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
ncr  Neurospora crassa
Pathway
ncr00250  Alanine, aspartate and glutamate metabolism
ncr00280  Valine, leucine and isoleucine degradation
ncr00410  beta-Alanine metabolism
ncr00640  Propanoate metabolism
ncr00650  Butanoate metabolism
ncr01100  Metabolic pathways
Module
ncr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ncr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    NCU08998
   00650 Butanoate metabolism
    NCU08998
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NCU08998
   00280 Valine, leucine and isoleucine degradation
    NCU08998
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NCU08998
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ncr01007]
    NCU08998
Enzymes [BR:ncr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     NCU08998
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     NCU08998
Amino acid related enzymes [BR:ncr01007]
 Aminotransferase (transaminase)
  Class III
   NCU08998
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 3875148
NCBI-ProteinID: XP_011393979
UniProt: U9W589
LinkDB All DBs
Position
Linkage Group III; III
AA seq 515 aa AA seqDB search
MASRLLRSSYSGSLRAVSTASTVRPAAVSAVHQFSNRRQFTASSSKMASSFYKDWEPEGP
TVKTEIPGPKAKEAIKELDEVFDTRSLNMLTDYHKSVGNYIADPDGNVLLDVYAQIASIP
IGYNNPVLQDAARSSDMVNSIINRPALGNFPPTDWASVLKTGILKVAPKGLNQVFTAMAG
SDANETAYKAAFMWRRQKERGGPQVEFTAEEMESAMINQSPGASSLSILSFKSAFHGRLF
GSLSTTRSKPIHKLDIPAFDWPQATFPLLKYPLEEHAEENAAAEQAALDEVEHLIKNYHI
PPAAVIIEPIQSEGGDNHASPAFFRGLRAITKKHGVLLIVDEVQTGVGATGKFWAHEHWD
LQDPPDMVTFSKKAQTAGYYFGNPELRPNKPYRQFNTWMGDPARALLFKAIIGEIERLGL
VEHTARVGDYLYGKLEGLAQKYPGQFANLRGKGQGTFIAFDNPRRDEFLARAKKFGVNIG
GSGQSAVRLRPMLIFEEKHADILVDALEKIVKSFQ
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggcctccagacttcttcggagcagctatagcggcagcctacgtgccgtttctactgct
tcgacggttcgacctgcggccgtttccgcagtacaccagttctctaaccgtcgccagttt
actgcctctagcagcaagatggcatcatcattctacaaggactgggagccagagggtccc
acggtcaagaccgagattccgggccccaaagccaaggaggccatcaaggagcttgatgag
gtctttgacactcggagcttgaacatgctcactgattaccataagagcgtgggcaactac
attgccgatcctgatggcaatgtcttgcttgatgtctacgctcaaattgcctccattccc
atcggctacaacaaccccgtcctgcaagacgccgcccgcagttccgacatggtcaacagc
atcatcaaccgccccgccctcggcaacttcccgcccaccgactgggcctcggtgctcaag
acgggcatcctcaaggtcgcgcccaaggggctcaaccaagtcttcaccgccatggccggc
tccgacgccaacgaaaccgcctacaaagccgccttcatgtggcgccggcaaaaggagcgc
ggcgggccccaggtggaattcaccgccgaagaaatggagtccgccatgatcaaccaatcg
cccggcgcttcgtccttgtccatcctctccttcaagtccgcctttcacggccgcttgttc
ggctcgctgtcgaccacccgctccaagcccatccacaagctggacatccccgctttcgac
tggccgcaggcgactttcccgctgctcaagtaccccctcgaagagcacgccgaagagaac
gcggccgccgagcaggccgcgctggacgaggtcgagcacctgatcaagaactaccacatc
ccgcccgcggcggtgatcattgagccgatccagtccgagggcggcgacaaccacgcctcg
cccgccttcttccggggtctgcgcgccatcaccaagaagcacggcgtcctgctgatcgtg
gacgaagtccagacgggcgtcggcgccacaggaaagttctgggcgcacgagcactgggac
ctgcaagaccctcccgacatggtgaccttttccaagaaggcgcagacggccggttactac
tttggcaacccggagctgcggcccaacaagccttataggcagttcaacacgtggatgggc
gacccggccagggctttgctcttcaaggccatcattggcgagattgaacggttgggacta
gtggagcatacggctcgcgtgggtgactatctgtatggcaagctggaaggactggcgcag
aagtatccgggccagtttgcgaatctgagaggcaaaggacagggaacgttcattgcgttt
gataacccgcgcagagacgagtttctggcgagggcgaagaagtttggggtgaatattggc
ggcagtggacagagcgcggttaggttgaggcccatgttgattttcgaggagaagcatgcg
gatatcttggtggatgctttggagaagattgtcaagtcgtttcaataa

DBGET integrated database retrieval system