KEGG   Neurospora crassa: NCU09281Help
Entry
NCU09281          CDS       T01034                                 

Gene name
gh31-1
Definition
(RefSeq) glycosylhydrolase 31-1
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
ncr  Neurospora crassa
Pathway
ncr00052  Galactose metabolism
ncr00500  Starch and sucrose metabolism
ncr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    NCU09281 (gh31-1)
   00500 Starch and sucrose metabolism
    NCU09281 (gh31-1)
Enzymes [BR:ncr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     NCU09281 (gh31-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 3874647
NCBI-ProteinID: XP_958500
UniProt: Q7S1M6
LinkDB All DBs
Position
Linkage Group VII; VII
AA seq 890 aa AA seqDB search
MIRMPKPAIALLSLFSIASAAPLATCPGYRVTNAQSGPSYLVADLTLAGTNCNLYSEDIT
NLRLTVEYQTDTRLHVLIADREQNVYQIQDNILPRPLSQNASSQTADLRFTYEAYPFSFK
VTRVSTGDVLFDTSPSPLIFETQYLRLRTRLPSNPNLYGLGEHSDSFRLATNGYKRTLWN
SEAPYIPQNQNLYGSHPVYFEHRGGNGTGGTHGVFLRSAAGMDVVIGKSDAGEQYLEYNT
IGGVLDFYFLAGPGPEEVSKQYAQVVGLPAMMPYWSLGFHQCKYGWPDLGHVKQVVQNYS
DAGIPLEALWDDIDYMDNKLDFSTDPVRYPHDQLKGFVDELHGKDMRYVQILDPGIRYKS
DYGPYTRGAEKDVFLKAADGSWYRGLQWPGEVVWPDWIAPQTKEWWTTEILTFYDPNNGI
NADGLWVDMNEASNMCADTTCLSSAQKTRSLPQSLIGKIHPRAPGDRHQKTRSLPQSLIG
KIHPRAPGDGQHLGLPNRDLFTPKYQIANHYPTLSSRTLFTNITNSDGSTQYDTHNLYAL
TMSSVSRSALISRSPTKRPFLLTRSTFSGSSRFAAHWFGDNFSSWADYRASIRQLLSFSA
IHNYPMVGSDVCGFNGQAQENMCARWAVLGAWQPFYRNHADISAPDQEFYRWPSVAAAAR
KAISVRYRLLDYIYTGLYYASKTGEPALAKPLWFLFPSDPATYGIDTQFFLGDALLVSPV
VEDDAHSVTFYLPQGKWYDFFTHHRIDQTSAGTVTVSGVGWDQIPVYIRGGSISALRLSD
ASFTTGQAMTTAEVRTRNFEIIIAPDQNGKARGRLYLDDGESLDSSGKESEIEFTWDGSK
FEAKGTFGYDTEGVVVQRIVLLDDGVSGNGQREVSGRWPLTGGFTTNLYI
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atgatcaggatgcccaaacccgccattgcgctgctgtcactgttctcgatagcatccgcg
gcgcctctggcaacttgcccaggataccgagtcaccaacgcccaatccgggccgtcgtat
ctcgtcgccgacctgactctcgccggcaccaactgcaatctctacagcgaagacattacc
aacttgcgcctgacagtggaataccagactgacacccgcctacacgtcttgatcgcagac
cgcgagcaaaacgtctaccagatccaagacaacatcctaccacggcctctctcacaaaat
gcctcctcccaaaccgccgatcttcgctttacctacgaagcctaccccttctctttcaaa
gttacacgcgtcagcaccggcgacgtccttttcgatacttctccttcacccttgatcttc
gaaacgcaatatctacgcctgcgcacgcgcttgccttcgaacccgaatttgtatgggctc
ggtgaacactcggattctttccggttggcgacaaacggatataagagaacgttgtggaac
tctgaggcgccgtacataccgcagaaccagaacttgtacgggagccatcctgtgtacttt
gagcaccgcggtggtaatggtacgggagggacgcatggagtcttcttaagaagtgccgcg
ggaatggacgttgtgattgggaagagcgatgccggggagcaatacctcgagtataacacc
attgggggagtgcttgacttttattttctggccggaccgggtcccgaggaagtaagcaag
cagtatgcccaagttgttggtctccccgcaatgatgccgtattggtcgctgggatttcac
cagtgcaaatacggctggccggatctggggcatgtcaaacaggtcgtccagaactacagc
gatgcgggaattccgttggaggcgctctgggatgatatcgattatatggacaacaagctg
gattttagtacggatccggtgcggtatcctcatgaccagctgaagggatttgtggacgaa
ctgcacggaaaagatatgcggtatgtgcagattctggatccggggatcaggtacaagagc
gactatggcccgtataccaggggtgccgagaaggatgtgtttctcaaggcagctgatggg
tcctggtatcgtggcctgcagtggcctggggaggtggtctggccggattggattgcgccg
cagacaaaggagtggtggacaacggagattctgacgttttatgatccaaacaacgggatt
aatgcggatgggctttgggtggacatgaatgaggcgagcaacatgtgtgcggacactact
tgtctctcttcggctcagaaaactcgctcactgcctcagtccctaatcggcaaaatccat
ccacgcgccccaggcgatagacaccaaaaaactcgctcactacctcaatccctaatcggc
aaaatccatccacgcgccccaggcgatggacaacacctcggcctccccaaccgcgacctc
ttcacccccaagtaccagatagcgaaccactaccccaccctctccagccgcaccctattc
acgaacatcaccaactcggacggctcaacgcaatacgacacccataatctctacgccctc
actatgtcctctgtctctcgctctgccctcatctcccgctcgcccaccaaacgtcccttc
ctcctcacccgttccaccttttcgggatcctcccgcttcgccgctcactggtttggcgac
aacttttcttcctgggccgactaccgcgcctcaatccggcagctcctcagcttcagcgcc
atacacaactaccccatggtcggttccgacgtctgcggcttcaacggccaggcccaagag
aacatgtgtgcacgctgggcagttctcggcgcttggcagcccttttaccgcaaccacgcc
gacatctccgctcccgaccaggaattctatcgatggccttctgtcgccgctgccgcgcgc
aaagcgattagtgtcaggtaccgactgctggattacatttacacaggcctttactacgcc
agcaaaacgggtgagccggcactagccaaaccgctctggtttctctttccctctgacccg
gcaacatacggcatcgacacgcagttcttcctcggcgacgcactgcttgtgtctcccgtg
gtggaagacgacgcccactctgtcacgttttacttgccccaagggaaatggtacgatttc
tttacgcatcaccggattgatcaaacctccgctggcaccgttaccgtgtccggagtaggt
tgggatcagatccctgtttatattcgcggcggaagtatctcggcccttcgcctttccgac
gcttcctttacgaccggacaggcaatgaccactgccgaagtccggacacgcaactttgag
atcatcattgcccctgatcagaacggcaaagcgaggggaagattgtatttggatgatggc
gagagtctggattcgagtgggaaggagagcgagattgagtttacctgggatgggtcaaag
tttgaggcgaaggggacgtttgggtatgacactgagggggtggtggtgcagaggatagtg
cttttggatgatggggttagtgggaatgggcaaagggaggtgagtgggaggtggccgttg
acggggggttttacgacgaatctgtacatatag

DBGET integrated database retrieval system