KEGG   Neurospora crassa: NCU09706Help
Entry
NCU09706          CDS       T01034                                 

Definition
(RefSeq) DNA ligase I
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ncr  Neurospora crassa
Pathway
ncr03030  DNA replication
ncr03410  Base excision repair
ncr03420  Nucleotide excision repair
ncr03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ncr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    NCU09706
   03410 Base excision repair
    NCU09706
   03420 Nucleotide excision repair
    NCU09706
   03430 Mismatch repair
    NCU09706
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ncr03032]
    NCU09706
   03400 DNA repair and recombination proteins [BR:ncr03400]
    NCU09706
Enzymes [BR:ncr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     NCU09706
    6.5.1.6  DNA ligase (ATP or NAD+)
     NCU09706
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     NCU09706
DNA replication proteins [BR:ncr03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    NCU09706
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     NCU09706
DNA repair and recombination proteins [BR:ncr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     NCU09706
   NER (nucleotide excision repair)
    Other NER factors
     NCU09706
   MMR (mismatch exicision repair)
    Other MMR factors
     NCU09706
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 3875111
NCBI-ProteinID: XP_958945
UniProt: Q7S2S0
LinkDB All DBs
Position
Linkage Group VII; VII
AA seq 917 aa AA seqDB search
MSSPAKKRKLNSGTKQSFSVPSRGLEYFFAKQKQNGASKEPSPLPKESDSQPAQQGSSEE
HLNDEELARKLQAEWDAEARASSTPRENDVRSQDVAVSTTEPVDTDGVEPTNESNPQTVT
APPKADRPKGKNTLSLSSAAATEDQASASIPLDESPLTFNPSKYIPQLQESWATDGGDAS
YALLIRCFVLVSSTTSRIKIVDTLVNCVRLLIEGDPSSLLPAVWLATNAISPPYVSMELG
LGGSAISKALKQVCGLDNRSLKALNDKLGDPGDVAFEAKKKQSFTLRKPKPLTIKGVFQS
LVKISKTQGQGSGDAKQRIVDKLLQDARGGEESRYVVRTLCQHLRIGAVKTTMLIALARA
FLLSKPPGANIPTKDPNQLAKLKKEELAEVYAKAEEIVKASYARHPDYNDLVPVLLETGV
SEELLVRCGLTLHIPLRPMLGGITRDLSEMLSRLQGRDFACEYKYDGQRAQIHCDDRGVV
SIFSRHLELMTDKYPDLVALVPKIRGEDVQSFIMEGEVVAVDRATGELKNFQTLTNRARK
DVAIGAITIDVCLFAFDLMYLNGQPLLNRSFRERRDMLRSLFMEIPHHFTWVKSIDATSQ
ESEIVLEFFKSAVDSKCEGIMVKILDNLPELEAPGPDDSTDPIIPTELVATSSDAVAVSV
SAKKSLKGMGKGNHAETKAPSDTPNPNSNEKKQSRRKPLLATYEPDKRLDSWLKVKKDYI
GTSAGVDTLDLIPIAAWHGTGRKAKWWSPILLAVRNEETGSLEAVCKCMSGFTDSFYKAN
REVYDKDGSFSSDGEPKNVHVAKPGFVEYAGGNPDVWFEPQEVWEVAFADITISPTYTAA
IGLVREDKGLSLRFPRFLRKREDKGIEEASTSDFLAGLWRKQEVKAPAPPPVEGGREIDE
AGLENEDEDDDEYEDGE
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgtccagtccagccaagaaacgcaaactcaactcgggcacaaaacaatctttttctgtt
cccagcagaggccttgagtactttttcgctaaacaaaagcagaatggtgcttctaaggaa
ccatctcctttgcccaaggaatccgactcccagcctgctcagcaagggtcgtcagaagag
catttgaatgatgaggagcttgcgcgaaagctgcaggccgaatgggatgctgaagcaagg
gcctcatcaacaccgagggaaaatgatgttcgctcgcaggatgtcgcagtgtcgacaaca
gagcccgtggacacagatggcgttgaaccaaccaatgagtcaaatccacagacagtaacc
gcaccacccaaggctgaccggcccaaagggaagaatacattgtcactctcttccgcagcc
gctacagaagaccaggcatcggcatctattcctcttgacgaaagtcccttgaccttcaat
ccatccaagtacatcccccagctccaggaatcgtgggccactgatggaggtgatgcgtcc
tacgccctccttatacgatgctttgtcttggttagcagcaccacaagcaggatcaaaatt
gtcgacacgctagtcaactgtgtccgactgttgattgaaggagatccgtccagcttgttg
cccgcagtatggctggcaacgaacgcaatttccccaccgtacgtgtctatggaacttggt
ttgggtggttctgctatctcaaaggctctcaaacaagtgtgtggcctggacaacaggtcg
ctcaaagcacttaacgacaagctgggtgacccgggcgatgttgcattcgaggcaaagaag
aaacagagctttactctacgaaagccaaaaccgttaacaatcaagggggtcttccagtca
ctggtcaaaatctccaagactcaagggcagggcagcggtgatgcaaagcagcggattgtt
gataaactgctccaggatgctcgcggaggtgaagaaagtagatatgtcgtcaggacatta
tgtcaacatttgcgcatcggagctgtcaaaaccactatgctcatcgccctagcccgagct
tttttgctttccaaacctccaggcgcgaacatcccgacaaaagacccaaatcaactggcg
aagctgaagaaagaggagctagccgaggtatatgcgaaggccgaggaaattgtcaaggcc
tcgtatgcccgacatccagattacaacgaccttgtcccggtactgctagagactggcgtg
tctgaggagttattggtgcgatgtggtctaacacttcacattccgttgcggcccatgctt
gggggcatcaccagggacttgtcagaaatgctctctcgacttcaagggcgtgatttcgct
tgcgagtacaagtacgacggccaacgtgcccaaattcattgtgacgataggggagttgtc
tccatcttttcccgccatctagaactcatgacagacaaataccccgatctcgtcgcgctc
gttcccaaaattaggggtgaagatgtccagagcttcatcatggagggcgaagtggtcgcc
gtggaccgggccacgggcgagctgaagaatttccagacgttaacgaaccgtgccagaaaa
gacgttgcaataggggccatcactatcgacgtgtgtctgttcgcattcgacctcatgtat
ctcaacggacaaccacttctcaacagatcattccgagaacgacgagacatgttgcgatca
ctctttatggagataccgcaccattttacatgggtcaaaagcatcgatgcgacatcccaa
gagtcggaaatagtcctcgagttcttcaagtcggccgttgatagcaagtgtgaaggtatc
atggtcaagattctcgacaatctaccagagcttgaggcccctgggcctgacgacagcacc
gacccaataatacccaccgagctggtcgctacctcctctgatgccgtcgcggtctcggtc
tcggccaaaaagtccctaaagggaatgggcaaaggcaatcacgcagaaacgaaagcacct
tccgatacgcccaaccccaactccaacgaaaagaagcaatcgcgccgcaaaccgctccta
gcaacctacgagcccgacaagcgtctcgactcctggctcaaagtcaaaaaagactacatc
ggcacctccgccggcgtcgacacgctggacctaatacccatcgccgcctggcacggcacc
ggccgcaaagccaagtggtggtcaccaatcctgctagccgtgcgcaacgaagaaaccggc
tcgctcgaagcagtgtgcaagtgcatgtcgggcttcaccgattccttctacaaagccaac
cgcgaggtttacgacaaggacggctccttcagttccgatggggagcccaagaatgtacat
gtggcgaagccgggatttgtcgagtacgcgggaggcaacccggatgtgtggtttgagccg
caggaggtgtgggaagtggcgtttgcggatatcacgattagtccgacgtacacggcggcg
attgggttggtgcgggaggataaggggctgagtttgaggtttccgaggttcttgcggaag
agggaggataagggaattgaggaggcaagtacgagcgattttttggcggggttgtggagg
aagcaggaggtgaaggcacccgcaccgccgccggtcgagggtggaagggaaattgatgaa
gcgggtttggagaatgaggatgaggatgacgatgagtatgaggatggagaatag

DBGET integrated database retrieval system