KEGG   Neurospora crassa: NCU09706Help
Entry
NCU09706          CDS       T01034                                 

Definition
(RefSeq) DNA ligase I
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ncr  Neurospora crassa
Pathway
ncr03030  DNA replication
ncr03410  Base excision repair
ncr03420  Nucleotide excision repair
ncr03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    NCU09706
   03410 Base excision repair
    NCU09706
   03420 Nucleotide excision repair
    NCU09706
   03430 Mismatch repair
    NCU09706
Enzymes [BR:ncr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     NCU09706
    6.5.1.6  DNA ligase (ATP or NAD+)
     NCU09706
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     NCU09706
DNA replication proteins [BR:ncr03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    NCU09706
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     NCU09706
DNA repair and recombination proteins [BR:ncr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     NCU09706
   NER (nucleotide excision repair)
    Other NER factors
     NCU09706
   MMR (mismatch exicision repair)
    Other MMR factors
     NCU09706
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 3875111
NCBI-ProteinID: XP_958945
UniProt: Q7S2S0
LinkDB All DBs
Position
Linkage Group VII; VII
AA seq 917 aa AA seqDB search
MSSPAKKRKLNSGTKQSFSVPSRGLEYFFAKQKQNGASKEPSPLPKESDSQPAQQGSSEE
HLNDEELARKLQAEWDAEARASSTPRENDVRSQDVAVSTTEPVDTDGVEPTNESNPQTVT
APPKADRPKGKNTLSLSSAAATEDQASASIPLDESPLTFNPSKYIPQLQESWATDGGDAS
YALLIRCFVLVSSTTSRIKIVDTLVNCVRLLIEGDPSSLLPAVWLATNAISPPYVSMELG
LGGSAISKALKQVCGLDNRSLKALNDKLGDPGDVAFEAKKKQSFTLRKPKPLTIKGVFQS
LVKISKTQGQGSGDAKQRIVDKLLQDARGGEESRYVVRTLCQHLRIGAVKTTMLIALARA
FLLSKPPGANIPTKDPNQLAKLKKEELAEVYAKAEEIVKASYARHPDYNDLVPVLLETGV
SEELLVRCGLTLHIPLRPMLGGITRDLSEMLSRLQGRDFACEYKYDGQRAQIHCDDRGVV
SIFSRHLELMTDKYPDLVALVPKIRGEDVQSFIMEGEVVAVDRATGELKNFQTLTNRARK
DVAIGAITIDVCLFAFDLMYLNGQPLLNRSFRERRDMLRSLFMEIPHHFTWVKSIDATSQ
ESEIVLEFFKSAVDSKCEGIMVKILDNLPELEAPGPDDSTDPIIPTELVATSSDAVAVSV
SAKKSLKGMGKGNHAETKAPSDTPNPNSNEKKQSRRKPLLATYEPDKRLDSWLKVKKDYI
GTSAGVDTLDLIPIAAWHGTGRKAKWWSPILLAVRNEETGSLEAVCKCMSGFTDSFYKAN
REVYDKDGSFSSDGEPKNVHVAKPGFVEYAGGNPDVWFEPQEVWEVAFADITISPTYTAA
IGLVREDKGLSLRFPRFLRKREDKGIEEASTSDFLAGLWRKQEVKAPAPPPVEGGREIDE
AGLENEDEDDDEYEDGE
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgtccagtccagccaagaaacgcaaactcaactcgggcacaaaacaatctttttctgtt
cccagcagaggccttgagtactttttcgctaaacaaaagcagaatggtgcttctaaggaa
ccatctcctttgcccaaggaatccgactcccagcctgctcagcaagggtcgtcagaagag
catttgaatgatgaggagcttgcgcgaaagctgcaggccgaatgggatgctgaagcaagg
gcctcatcaacaccgagggaaaatgatgttcgctcgcaggatgtcgcagtgtcgacaaca
gagcccgtggacacagatggcgttgaaccaaccaatgagtcaaatccacagacagtaacc
gcaccacccaaggctgaccggcccaaagggaagaatacattgtcactctcttccgcagcc
gctacagaagaccaggcatcggcatctattcctcttgacgaaagtcccttgaccttcaat
ccatccaagtacatcccccagctccaggaatcgtgggccactgatggaggtgatgcgtcc
tacgccctccttatacgatgctttgtcttggttagcagcaccacaagcaggatcaaaatt
gtcgacacgctagtcaactgtgtccgactgttgattgaaggagatccgtccagcttgttg
cccgcagtatggctggcaacgaacgcaatttccccaccgtacgtgtctatggaacttggt
ttgggtggttctgctatctcaaaggctctcaaacaagtgtgtggcctggacaacaggtcg
ctcaaagcacttaacgacaagctgggtgacccgggcgatgttgcattcgaggcaaagaag
aaacagagctttactctacgaaagccaaaaccgttaacaatcaagggggtcttccagtca
ctggtcaaaatctccaagactcaagggcagggcagcggtgatgcaaagcagcggattgtt
gataaactgctccaggatgctcgcggaggtgaagaaagtagatatgtcgtcaggacatta
tgtcaacatttgcgcatcggagctgtcaaaaccactatgctcatcgccctagcccgagct
tttttgctttccaaacctccaggcgcgaacatcccgacaaaagacccaaatcaactggcg
aagctgaagaaagaggagctagccgaggtatatgcgaaggccgaggaaattgtcaaggcc
tcgtatgcccgacatccagattacaacgaccttgtcccggtactgctagagactggcgtg
tctgaggagttattggtgcgatgtggtctaacacttcacattccgttgcggcccatgctt
gggggcatcaccagggacttgtcagaaatgctctctcgacttcaagggcgtgatttcgct
tgcgagtacaagtacgacggccaacgtgcccaaattcattgtgacgataggggagttgtc
tccatcttttcccgccatctagaactcatgacagacaaataccccgatctcgtcgcgctc
gttcccaaaattaggggtgaagatgtccagagcttcatcatggagggcgaagtggtcgcc
gtggaccgggccacgggcgagctgaagaatttccagacgttaacgaaccgtgccagaaaa
gacgttgcaataggggccatcactatcgacgtgtgtctgttcgcattcgacctcatgtat
ctcaacggacaaccacttctcaacagatcattccgagaacgacgagacatgttgcgatca
ctctttatggagataccgcaccattttacatgggtcaaaagcatcgatgcgacatcccaa
gagtcggaaatagtcctcgagttcttcaagtcggccgttgatagcaagtgtgaaggtatc
atggtcaagattctcgacaatctaccagagcttgaggcccctgggcctgacgacagcacc
gacccaataatacccaccgagctggtcgctacctcctctgatgccgtcgcggtctcggtc
tcggccaaaaagtccctaaagggaatgggcaaaggcaatcacgcagaaacgaaagcacct
tccgatacgcccaaccccaactccaacgaaaagaagcaatcgcgccgcaaaccgctccta
gcaacctacgagcccgacaagcgtctcgactcctggctcaaagtcaaaaaagactacatc
ggcacctccgccggcgtcgacacgctggacctaatacccatcgccgcctggcacggcacc
ggccgcaaagccaagtggtggtcaccaatcctgctagccgtgcgcaacgaagaaaccggc
tcgctcgaagcagtgtgcaagtgcatgtcgggcttcaccgattccttctacaaagccaac
cgcgaggtttacgacaaggacggctccttcagttccgatggggagcccaagaatgtacat
gtggcgaagccgggatttgtcgagtacgcgggaggcaacccggatgtgtggtttgagccg
caggaggtgtgggaagtggcgtttgcggatatcacgattagtccgacgtacacggcggcg
attgggttggtgcgggaggataaggggctgagtttgaggtttccgaggttcttgcggaag
agggaggataagggaattgaggaggcaagtacgagcgattttttggcggggttgtggagg
aagcaggaggtgaaggcacccgcaccgccgccggtcgagggtggaagggaaattgatgaa
gcgggtttggagaatgaggatgaggatgacgatgagtatgaggatggagaatag

DBGET integrated database retrieval system