KEGG   Neurospora crassa: NCU16729
Entry
NCU16729          CDS       T01034                                 
Name
(RefSeq) hypothetical protein
Organism
ncr  Neurospora crassa
SSDB
Motif
Pfam: 2EXR
Other DBs
NCBI-GeneID: 23569625
NCBI-ProteinID: XP_011394358
UniProt: V5IM54
LinkDB
Position
IV:complement(476174..477007)
AA seq 277 aa
MATSFHLFPHLPWEIRARIWELTIEPRTVDIRISHEWEDISDDVKAKYNHSRLGVLRLRS
STPVPAPLQACREARSHLGHRFYHKAFKQLPAARSDSETVRCDTPEDRLELGLEAEPRYI
WVNFDVDLINTGDTPFKDFESHLLDLKRWKFARDRYSMDDYEAKVLGKVVNAKEIHVVCL
GPRGASDWEGTYEQCCVPCDKDRFWLIDPIHGRTVTAIENNALCDEAWIRDYRKAGAYLD
PNTMQPFVPYLPPGWFEGRERWDVIYRWSRGYEESYR
NT seq 834 nt   +upstreamnt  +downstreamnt
atggccacttccttccacctcttcccccatctcccgtgggagattcgggcacggatatgg
gagctcactatcgaacctcgcacggttgacatccgcatctcccacgagtgggaggacatt
agcgacgatgtcaaagccaaatacaaccattcaaggctcggtgtccttcgtttgcgctca
tccacccccgttccggcacctttacaagcttgccgagaggcccggagccatctcgggcac
cgattttaccacaaggccttcaaacagttgcccgctgcgaggtcggactcggagacagtg
aggtgcgacacacccgaggaccggctggagctgggcctggaggcagaaccgcgctacatc
tgggtcaatttcgacgtggacctgatcaacaccggggacacccctttcaaggactttgaa
tcccatttgttggacctcaagcggtggaaatttgcgcgggacagatattcgatggacgac
tatgaagccaaagtcttggggaaagtcgtcaatgcaaaagagattcacgtcgtctgtctg
ggcccccgcggagctagcgattgggaaggcacgtatgaacaatgctgtgtcccctgcgac
aaagataggttctggctcatcgatccgattcacggtcggacggtgaccgcgatcgaaaat
aacgccttatgcgatgaagcgtggatcagggactataggaaagccggtgcctacctcgat
cctaatactatgcagccttttgtgccctatctcccgccaggctggttcgagggacgggag
cgatgggatgtaatttaccgttggagcaggggctacgaggaatcctacaggtag

DBGET integrated database retrieval system