KEGG   Naumovozyma castellii: NCAS_0A02510Help
Entry
NCAS_0A02510      CDS       T02233                                 

Gene name
NCAS0A02510
Definition
(RefSeq) hypothetical protein
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ncs  Naumovozyma castellii
Pathway
ncs00020  Citrate cycle (TCA cycle)
ncs00480  Glutathione metabolism
ncs01100  Metabolic pathways
ncs01110  Biosynthesis of secondary metabolites
ncs01130  Biosynthesis of antibiotics
ncs01200  Carbon metabolism
ncs01210  2-Oxocarboxylic acid metabolism
ncs01230  Biosynthesis of amino acids
ncs04146  Peroxisome
Module
ncs_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ncs_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ncs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NCAS_0A02510 (NCAS0A02510)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NCAS_0A02510 (NCAS0A02510)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    NCAS_0A02510 (NCAS0A02510)
Enzymes [BR:ncs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     NCAS_0A02510 (NCAS0A02510)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 11527065
NCBI-ProteinID: XP_003673200
UniProt: G0V5S1
LinkDB All DBs
Position
1:complement(476363..477643)
Genome map
AA seq 426 aa AA seqDB search
MQFTRLFSSTTARSLAKIKVKTPIVEMDGDEMTRIIWSQIKTKLIKPYLDVPLEYYDLSI
ENRDATKDQVTVDSANATLKHGVAVKCATITPDEQRVKEFNLQKMWKSPNGTIRNILGGT
VFREPIVIPNIPRLVPGWEKPIIIGRHAHADQYKATDCLIPGPGKLHLKWTPENGTAGDA
IDLQVYDYQGSGVALAMYNTDESIRGFAHSSFKLALTKKLNLFLSTKNTILKKYDGRFKD
IFQEIFDMEYKTKFANLGISYEHRLIDDMVAQMIKSKGGFIMALKNYDGDVQSDIVAQGF
GSLGLMTSILVTPDGKTFESEAAHGTVTRHYRKFQKGEETSTNSIASIFAWSRGLAKRGE
LDGTPDVVRFANLLEAATLNTVQQDGIMTKDLALAQGKTDRSSYVTTDEFIDAVEKRLQM
EIKSID
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcaattcactagactgttctcctctacgacggcaagatctcttgccaagatcaaagtc
aagacccccatcgtcgagatggacggtgatgaaatgactcgtataatttggtcccagatc
aagactaaactaatcaagccatatctagatgttcctttggaatactatgatttatccatt
gaaaaccgtgacgccacgaaggatcaagtcacagtggattccgctaatgctactttaaaa
catggtgttgcagtcaaatgtgccactattacacctgatgaacaacgtgtgaaggaattt
aacttgcaaaagatgtggaaatctccaaatgggaccattagaaatatattgggtggtact
gtttttagagaaccaatcgtcattccaaatattcctcgtttggttcctggttgggaaaaa
cctatcattattgggagacatgcgcatgcggatcaatataaggctaccgattgtttgatt
ccaggtccagggaaactacatttgaaatggactcctgaaaatgggaccgctggagacgcc
attgatttacaagtttatgattatcaaggatctggtgtcgctttagctatgtacaataca
gatgaatctatcagaggatttgctcactcatccttcaaattagctttaactaagaaatta
aacttattcttatccactaagaatactatcttgaagaaatatgatggtagatttaaggat
attttccaagaaatttttgatatggaatataagactaaatttgctaatttgggaatctct
tatgaacatcgtttgattgatgatatggttgcacaaatgatcaagtctaagggtggtttt
atcatggctttgaaaaattacgatggtgatgttcaatccgatattgtcgctcaagggttt
ggttctcttggattaatgacctctatcttagtgacccctgatgggaagacatttgaaagt
gaagctgctcatggtaccgtgacaagacattatagaaagttccaaaagggcgaagagaca
tcaacaaattcaattgcttccatttttgcatggtcaagagggttagctaagagaggtgaa
ttagatggaactccagatgtggttagattcgccaatttgttggaagctgctacattaaat
accgttcaacaagatggaataatgacaaaggatttggctttagctcaaggtaagactgat
agatcttcatatgttactactgatgaatttatcgatgctgttgagaaaagactacaaatg
gaaattaaatccattgattaa

DBGET integrated database retrieval system