KEGG   Naumovozyma castellii: NCAS_0A04010
Entry
NCAS_0A04010      CDS       T02233                                 

Gene name
NCAS0A04010
Definition
(RefSeq) hypothetical protein
  KO
K12766  serine/threonine-protein kinase MDS1/RIM11 [EC:2.7.11.1]
Organism
ncs  Naumovozyma castellii
Pathway
ncs04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:ncs00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    NCAS_0A04010 (NCAS0A04010)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ncs01001]
    NCAS_0A04010 (NCAS0A04010)
Enzymes [BR:ncs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     NCAS_0A04010 (NCAS0A04010)
Protein kinases [BR:ncs01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   NCAS_0A04010 (NCAS0A04010)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Choline_kinase APH FAS_meander
Other DBs
NCBI-GeneID: 11529459
NCBI-ProteinID: XP_003673346
UniProt: G0V667
LinkDB
Position
1:complement(809163..810299)
AA seq 378 aa
MDQKTEESGPSPVITNPQDLLVRKQVYRGHPLLNADDSNNDPITITFPTTEIIGKGSFGL
VFCTTIRETDEVVAIKKVLQDRRFKNRELEIMKLIQHPNVINLKYYFYEKDVDDEVYLNL
ILDYMPQSLYQRLRHFVHQRQSMSRLEIKFYMFQLFKSLNYLHNAKNVCHRDIKPQNILV
DPNSWNLKLCDFGSAKQLKPTEPNVSYICSRYYRAPELIFGATNYSNQIDIWSSGCVMAE
LLLGQPMFPGESGIDQLVEIIKILGTPSKQEICAMNPNYMEHKFPQIKPIPLAKVFKKED
ELTVDFLINTLKYDPMERFNSLQCLCSTYFDELRYGEGKIKEITTDLKLLEFKVDDELSH
LTPDQLEIIKQKLALIPI
NT seq 1137 nt   +upstreamnt  +downstreamnt
atggatcaaaaaactgaagaatctggtccctctcctgtaattactaacccgcaagattta
ttagtgcgcaaacaagtatatcgcggtcatccattattgaatgcagatgacagtaataat
gatccaataacgataacgttcccgacaacggaaattataggtaaaggttcattcggactt
gtcttttgtacaacaataagagaaacagatgaagtggtcgcaataaagaaagtcttacaa
gaccgaaggtttaaaaatagagaactggaaataatgaaattaattcaacatccaaatgta
attaatttgaaatattatttttatgaaaaggatgttgatgatgaagtttatctaaattta
atcttggattatatgccgcaatctttatatcaaagattaagacatttcgttcatcaacgt
caatcaatgtcaagattagaaattaaattttacatgtttcaacttttcaaatcattaaat
tatttgcataatgcgaaaaatgtttgtcatagagatattaaaccacaaaatattctcgtg
gatccaaattcttggaatttaaaactttgtgattttggtagtgcaaagcaattaaaacca
acagaaccaaacgtttcttatatttgttcgagatattatagagctccagaattaatcttt
ggtgctacaaattattcaaatcaaatcgatatttggtcaagtggatgtgtaatggctgaa
ttattattgggtcaaccaatgtttcccggagaaagtggtatagaccaattagtggaaatt
attaaaatattggggactccatcaaagcaagaaatttgtgccatgaatccaaattatatg
gaacataaattcccacaaattaaaccaataccattagcaaaagtatttaaaaaggaagat
gagttaacagtagatttcttaataaatactttgaaatatgatccaatggaacgatttaat
tcattacaatgtctttgttccacttatttcgatgaactaagatatggtgaaggtaagata
aaagaaattacgacagatttgaaattattagagtttaaagtggatgatgaattgagtcat
ttaacaccagatcaactagagattataaagcaaaaattggctctcataccaatatga

DBGET integrated database retrieval system