KEGG   Naumovozyma castellii: NCAS_0A07660Help
Entry
NCAS_0A07660      CDS       T02233                                 

Gene name
NCAS0A07660
Definition
(RefSeq) hypothetical protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
ncs  Naumovozyma castellii
Pathway
ncs00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:ncs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NCAS_0A07660 (NCAS0A07660)
Enzymes [BR:ncs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     NCAS_0A07660 (NCAS0A07660)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     NCAS_0A07660 (NCAS0A07660)
    1.1.1.-  
     NCAS_0A07660 (NCAS0A07660)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C NAD_binding_7 Pyr_redox_3 Shikimate_DH AdoHcyase_NAD
Motif
Other DBs
NCBI-GeneID: 11526899
NCBI-ProteinID: XP_003673705
UniProt: G0V776
LinkDB All DBs
Position
1:complement(1525755..1526915)
Genome map
AA seq 386 aa AA seqDB search
MRAIAYYKKGDIHFASDLPTPTISTPDEILIDVAWCGICGSDLHEYLDGPIFMPQDGSTH
PLSNQPLPQPMGHEFCGFVKAIGNKVTKVAVGDKVVVEAGCGCKDVHRWPQSHVYGKEQC
TACRKGFDNCCTHAGFTGLGVVGGAFAEQVVVGERHVVKLPEEVPTDVGALVEPLSVAWH
AVKVAGFEKGSGKNALVLGAGPIGLATILALKAHGASKIVVSELAAIRRELALKMGVEVF
DPSKHGDEKQGIKKLREIPEDHDGFDFAFDCSGVETTFNTALHSLTFRGTAVNVAIWGPH
PIDYYPMDITLQEKKLTGSIGYVVQDFEEVVDALHKGDISIEECKHLITGRQKLENGWEK
GFMELMNHKETNIKILMTPNNHHELQ
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgagagccatcgcatactacaagaagggcgacattcatttcgcttcggatctccccacc
cccacaatcagcactccagatgaaatcctcattgacgtagcctggtgtggtatctgcggt
tcagaccttcacgaataccttgacggtcccatcttcatgcctcaagacggttccacacac
cccttatcaaaccagccactgccacagcccatgggtcatgaattctgcgggttcgtcaag
gcgattggtaataaagtgactaaagtcgccgtcggtgataaagtcgtggtggaggcagga
tgtggttgtaaagatgtccacagatggccccaatcacacgtctatggcaaagaacaatgt
actgcctgtcgtaagggatttgataattgttgtactcatgctgggttcaccggattgggt
gtcgtgggtggtgccttcgctgaacaggtcgttgtcggagaaagacatgtagttaagtta
cccgaggaggtccccactgatgttggggcccttgtggaaccattgtctgttgcatggcat
gctgtgaaagtggctggtttcgagaagggttcagggaaaaatgccttagtcctgggggca
ggacccattggattagctactattttggctttgaaggcacatggtgccagtaagattgta
gtttctgaactagcagccattagaagagaattggccctgaaaatgggagtggaagttttt
gatccatcgaagcatggtgatgagaagcaaggtattaagaagttgcgtgagatcccggag
gatcatgatggatttgatttcgcatttgattgttctggtgtggaaaccactttcaatacg
gcgttacattccttgacattcagaggtactgcggtgaacgttgccatttgggggcctcac
cccattgattattaccctatggacatcactttacaggagaagaaacttactgggtccatt
ggatatgtggtgcaagattttgaagaagtcgtggatgcacttcataagggtgacattagc
attgaggaatgtaagcatttgattactggtagacagaaattagagaacggttgggagaag
gggttcatggagttaatgaatcacaaggagaccaatattaagatcttgatgactcccaat
aaccaccacgaattgcaatga

DBGET integrated database retrieval system