KEGG   Naumovozyma castellii: NCAS_0B03530Help
Entry
NCAS_0B03530      CDS       T02233                                 

Gene name
NCAS0B03530
Definition
(RefSeq) hypothetical protein
  KO
K19589  release factor glutamine methyltransferase [EC:2.1.1.297]
Organism
ncs  Naumovozyma castellii
Brite
KEGG Orthology (KO) [BR:ncs00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ncs03012]
    NCAS_0B03530 (NCAS0B03530)
Enzymes [BR:ncs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.297  peptide chain release factor N5-glutamine methyltransferase
     NCAS_0B03530 (NCAS0B03530)
Translation factors [BR:ncs03012]
 Eukaryotic Type
  Release factors
   NCAS_0B03530 (NCAS0B03530)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTS PrmA Methyltransf_25 Methyltransf_23 Methyltransf_33 Met_10 AbrB_C UPF0020 rRNA_methylase
Motif
Other DBs
NCBI-GeneID: 11525970
NCBI-ProteinID: XP_003674810
UniProt: G0VBW0
LinkDB All DBs
Position
2:621802..622467
Genome map
AA seq 221 aa AA seqDB search
MLATPYIKCDYDKVYEPAEDSFLLLDSLEKEQQFLNERFHSHLSVVCELGPGSGIITTFM
LQHGIPSKNKSIYFALDINPWALEATHATAKLNACQDKFLDTVQSDLTSSLRNKEIDVLV
FNPPYVPADNVPMVPSFKDDIDEWVDLALLGGADGMVVTNKVLKNLDIILSPNGVAYILF
CARNKPEEVVKGMKEKHGWKAELVEHRKAGWEVLSVYKFYR
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgctagcgacaccatatatcaaatgtgactacgataaagtttacgaaccagccgaggat
agctttcttcttttagactctcttgagaaggaacagcaattcctaaatgaaagattccat
tctcatctatctgtagtatgtgagctgggccccggttcaggaataattacgaccttcatg
ttacagcatgggataccatccaagaataaatctatatatttcgcgctagacataaatcct
tgggctttagaggctactcatgccactgcaaaattaaacgcttgccaagataaattcctg
gatactgttcaaagtgatttaacctcctctttaaggaataaagaaatcgacgtattggta
ttcaatccaccatatgtaccagctgacaatgttccaatggttccaagcttcaaagacgat
atcgatgaatgggtggatctggcacttttgggaggagcagatggaatggttgtcacgaac
aaagtacttaaaaacttggacatcatcctctcccccaatggtgttgcatacatcttattc
tgcgccagaaataaaccagaagaagttgtgaagggaatgaaggaaaagcatggctggaag
gccgaattagtcgagcatagaaaggcaggttgggaagttttaagtgtttataaattttat
agataa

DBGET integrated database retrieval system