KEGG   Naumovozyma castellii: NCAS_0B03540Help
Entry
NCAS_0B03540      CDS       T02233                                 

Gene name
NCAS0B03540
Definition
(RefSeq) hypothetical protein
Organism
ncs  Naumovozyma castellii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dopey_N Casein
Motif
Other DBs
NCBI-GeneID: 11524813
NCBI-ProteinID: XP_003674811
UniProt: G0VBW1
LinkDB All DBs
Position
2:complement(622522..627573)
Genome map
AA seq 1683 aa AA seqDB search
MSLPLKPFTIDSHSKHLDSKQKKFQTSIQRALERFDSVTEWADYIASLGTLLKALQSWTP
KFQNVKYYVPEPYQVSRRLTSSLSPSLPAGVHQKTLEVYTFIFENIGRETLSAESNIWVP
GILPLMSYASMTVKSHLIELYEKYLVVLPSDTLKLLIRPLLASLFPGIDDESNEFLPLTM
RLIETLKNNLKDDSLFWQTTFLVITTSKDRRLGGLVWLTKKFPSLNEVPHLVAERNKSEI
ADTSDKKNKKETVLSTLLPEAKSLVSPEPGMLIRCMVRCLDDENDLLIKRGLLDLLVQRL
RIDSPVLVTLANFNDTKLLVLSCCKTALNKDMSLNRRIWNWLLGPATGTSANNLTKEESQ
KISSDDLGQNNEYFSKYGFKPLIEGLNDMLEREETLVVAFKICLAVMDRWEIGSLIIPEM
FIKLLIAAKKFSENQNVIKAASSFFDAVETNIIWGKMFEWLMVSHDLDFLQFVISTFNVS
NDEEIIVRHLPLMLLAVLSFPTSETNSKDSSFLRYDLCKKLLDHIPERAFLPLNHSSLND
DEYAETDKILDKILNYYKCVADPLKVPIPENPDMSLFPFSSEDLTFLIFRRMEDLLIDDL
VTYENVNAMATVFILAFEKIPSQSDTVESHPQVSLENKLIQPIFQAVRNYPSSGESNPII
GIVNIYSNYLISRMPFIDSMKLLKLVMERLWCYMKKAKTQSVAINCLKSLERCISSQYIE
SALSNCFVKEKDVTKRLAVLDLLWTRLGSDTSILNHPLQLIMDELFDNQNPYYLSVSKWI
SLILSSGSSNRFYKIMVENILNFQFFERGNLIELDDLDAFTYYVQSLTNVLKTNSDEILK
NFGLELTKSVSIDRWPNEDTSTYKTLMIVATLKFLDIKQNNHVRSIRSSLILLDCLLDGS
ESNFKDIVIFLLHMSSNYINGGELESELIAVSLLDIVSKVLRLSHANTIKLNIFDDNATH
LKYIDYLVTSVTTMEAPLVVASYVNLLSESTFYFEQSIFTMILPLTSSLVQSIQRLFTLF
KQTGSHFESISLFMRGIQDLLQISHGYLTAAERDGTLTGAGSKGDFFQSVVSNVFYSESS
TMDSKLQGERDVILQCFKQVIKCCLDIWCWSHEHAETSTEGNAQEVSNYNAYKFKFKSKE
LLEKLFFLEPSEVLETMISLRDDESTVTLIHVLDGNKPAVSIPYIFSSVISRYNRSFSAK
FSVSPVAKIGTSKINGVETSLYKKLSGVKIMHFLLRYVVSLENSSIEEFYGDFIIFFKEV
STNYSFYNEISLLVLKFVSIIAEKIARSQFGEQKRIRRDIADTFMKYISNALSDSTSGST
VEPQTYADVNFLIPRISSIVNENVSGDKFGITITTIVTKYISPALKNKGDTTFSSDITDL
ILTITKYGSKVKLWRNLLNDFFQDDKKLHVIGTNPIWREIILEWTLYADIKARLMSDLLL
VTESKKVGLTPTIIAFNSWNDAEIDNKCHNFLRISYILLIAPKDTYLLHFQALISCVSQY
LISKESKIQSKCWILLRAMFLRFSESHFNDFWSMITYCLQTNLQEFYESLQIQAEIDSDI
VLQICKTLDLLLSLNLEGFSATNEWLFVIDTINCIYKTNPYIALADEIFETKEFESNKLN
TLNLANQADTVLPLLTGIHSIEKYTQLKNFFQNLSYSHYETTYSLKATDYQACENDLMLD
IFT
NT seq 5052 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttaccattaaagccatttacaattgactcgcatagtaagcatctggattcaaag
caaaagaaatttcagacaagtattcaaagagctctcgaaagatttgattcagtaacagaa
tgggctgattatatagccagtttaggtacattattaaaggcattacaaagctggacaccc
aaattccaaaatgtgaaatattacgttcccgaaccttaccaggtcagccgaagactcacc
tcatcgttgtcccctagtctacctgcaggtgttcatcaaaagacattagaggtttataca
tttatcttcgaaaatattggacgagaaacattatcggcagagagtaatatctgggtccca
gggattttacccttgatgtcatatgcttccatgacagtaaaatctcatctaattgagttg
tatgagaaatatttagttgttctaccttcagatacattaaaactattgattagaccattg
ttagcaagtttgtttccaggtattgacgacgaaagtaacgaattcttacctttaacgatg
agattaattgaaacattgaaaaataatttaaaagatgattcattattttggcaaacaaca
ttcttagtaattacaacaagcaaagatcgaagattagggggacttgtatggttaactaaa
aagtttccatcattaaatgaggtgccccatttggttgcagaaagaaacaagagtgaaatt
gcagacacttctgataagaaaaataaaaaagaaactgttttatccacacttctaccagaa
gcgaagagtttggtctctcctgaaccaggaatgttgattcgttgtatggttcgttgctta
gatgacgaaaatgacttattgattaaaagaggattattggacttacttgtccagcggtta
agaattgactcaccggtcctagtaacattggcaaactttaatgacactaagctactggta
ctgagttgctgtaagacggctttgaataaagatatgtcattgaatcgaagaatttggaat
tggcttcttggacctgctaccggcacctctgcaaataatttaacaaaggaggaatctcaa
aagatcagttcagatgatcttggacaaaataatgaatatttttccaaatatgggtttaag
cctcttatagagggtctgaatgatatgcttgaaagagaggaaacgttggtagttgccttc
aaaatatgcttagccgtaatggacagatgggaaataggttcattaattataccagaaatg
tttattaagcttctcattgcggcaaaaaagttttctgaaaaccaaaatgtgatcaaggct
gccagtagtttcttcgatgccgtggaaacaaatattatatggggcaaaatgtttgaatgg
ttgatggtttcacacgatttagatttcttgcagtttgttatatctacctttaatgtaagc
aatgatgaagaaataattgtccgccatctaccgctgatgttgttggcagttttatccttc
ccaacctctgaaacaaacagtaaggattcgtcatttttgaggtacgatttgtgtaaaaaa
ttgttagatcacattcctgaacgtgcattcttaccattaaaccactcaagcttgaacgat
gatgaatacgctgaaactgataagatattggataaaatattgaactactataaatgtgta
gctgaccctctgaaagtgcccatccctgaaaatccagatatgtcgctattccccttcagt
tcagaagatttaacatttctgatttttcgccgaatggaagatttacttatcgatgatctt
gtcacctatgagaacgttaatgcaatggcaactgttttcatcttggcttttgagaaaatt
ccttctcaatcagataccgttgaatcacaccctcaagtctcgttagaaaataaactcatt
caaccaatttttcaagccgtaaggaattacccatcatcaggagaatctaatccaataatt
ggtatagtaaatatctacagtaattacctcattagccgcatgccttttattgattctatg
aaattgcttaaacttgttatggaacgtctgtggtgctatatgaaaaaggctaaaacacaa
tctgtcgcaatcaattgcctgaaatctttagaaaggtgtatatcatcacagtacattgaa
agtgcattatccaattgctttgttaaagaaaaagatgttacgaaacgtttggctgttttg
gatctgctgtggactagacttggttcagatacatccattttgaaccatccactacaattg
atcatggatgaactttttgataatcaaaatccttactaccttagtgtctcgaaatggata
tcactaattctatcttctggatcctcgaatcgtttctacaagatcatggtagaaaacata
ttaaacttccaattttttgaaagaggtaatcttatagaattagatgacttggatgcattc
acatactatgtgcaaagcctaacaaatgttttaaaaacaaacagtgatgaaattttgaag
aattttggcttagaattgactaaatcagtttcgatcgataggtggccaaatgaagatact
tctacctataaaacattaatgatagtggcaaccttgaaatttttggatataaaacaaaat
aaccatgtcaggagtattcgaagctcattaatcttgcttgattgtctattagatggatct
gaaagcaattttaaggatatcgttatttttctattgcatatgtcctctaattatattaat
ggtggagagttagagtctgaattgattgctgtttcattgttggatattgtgtctaaggtg
ctccgactatcacatgcgaataccatcaagttgaatatatttgatgacaacgccactcat
ttgaagtatattgattatttagttacaagcgtaactacaatggaggcacctctagttgtc
gcctcgtatgtgaatctactgtctgaaagtaccttttattttgagcagtccatattcact
atgatattgcctttgacgtcgtcattagtccaaagtatccagcgtctttttaccttattt
aagcagactggtagccatttcgaatctatttctttattcatgcgcggcatacaggatctt
cttcaaatatctcatggatatttgactgcagctgaacgagatggaacactcactggtgca
ggttcgaaaggtgattttttccaatcagttgtttcaaatgttttttattcagagtcatct
acgatggattcgaaacttcaaggtgaaagagatgttattctccaatgcttcaaacaagta
attaagtgttgtcttgatatatggtgttggtcgcatgaacatgccgaaacttctactgag
ggaaatgctcaggaagtttctaactacaatgcttataaatttaaattcaaatctaaggaa
ttgttggagaaactattttttttagaaccttctgaggttctagagactatgataagttta
cgtgatgatgaaagtacagtcaccctaatccatgtcctagatgggaataaaccagctgtg
agtattccatatatcttctccagtgtaatttccaggtacaatcggagtttttcagcgaag
ttttctgtttctccagttgcaaaaataggtacatctaaaattaatggggttgaaacttca
ttatataaaaaattatctggggttaaaataatgcacttccttcttcgatacgttgtatct
ttagaaaattcctctattgaagaattttacggcgacttcatcatattcttcaaagaagtt
tctactaattattcgttttacaatgaaatatcacttttagtgttgaaatttgtgagtatt
atagccgagaaaatagcaaggtctcaattcggtgaacagaaacgtataagaagagacata
gctgatacttttatgaagtacatttctaatgcactttctgattcaacttcaggatccact
gttgaacctcaaacctatgctgacgttaactttttaattccaagaatttcaagtatagtc
aatgaaaatgttagtggtgacaaatttgggataactataactactattgtaactaagtat
atttctccagctctgaaaaataaaggtgataccaccttttctagtgatattacagatctt
atattgacgattaccaaatatggaagtaaagttaaattatggaggaatttactaaacgac
ttttttcaagatgataaaaagttacatgtaattgggacgaatcctatctggagagaaatt
atacttgaatggactttgtatgctgacattaaggcaaggttaatgagtgatttattactt
gttactgagtccaaaaaggttggtttaacgccaacaattattgcgtttaattcatggaat
gatgcagagattgataataaatgtcataatttcttaagaatttcttatatattgttaatt
gcgcctaaggacacctacttattacatttccaagcgttaatatcctgtgtctcccaatat
ctaatatccaaggaatctaaaattcaatcgaaatgctggattttacttcgagcaatgttt
ttaagattttctgagtcccacttcaatgatttttggtctatgattacttattgtctccaa
actaatttacaagaattttatgaatcattacagatacaggccgaaatcgattctgatatt
gtattacagatttgtaaaactttagacttgttattgtcactaaatcttgaaggatttagt
gctacgaatgaatggttgtttgttattgatacgattaattgtatctataaaacaaatcca
tatatagcattggcggatgaaatatttgagaccaaagagtttgaaagtaataagctcaat
acattaaaccttgctaaccaagctgatactgtgttaccgctattaactggtatacatagt
attgaaaaatacactcaattgaagaacttcttccaaaatttaagctactcacattacgag
accacttacagtttgaaagctactgattatcaagcttgtgaaaacgatctgatgcttgat
attttcacttga

DBGET integrated database retrieval system