KEGG   Naumovozyma castellii: NCAS_0B03550Help
Entry
NCAS_0B03550      CDS       T02233                                 

Gene name
NCAS0B03550
Definition
(RefSeq) hypothetical protein
  KO
K13341  peroxin-7
Organism
ncs  Naumovozyma castellii
Pathway
ncs04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ncs00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    NCAS_0B03550 (NCAS0B03550)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WD40 ANAPC4_WD40
Motif
Other DBs
NCBI-GeneID: 11526010
NCBI-ProteinID: XP_003674812
UniProt: G0VBW2
LinkDB All DBs
Position
2:complement(627953..629080)
Genome map
AA seq 375 aa AA seqDB search
MLKYHMQGFSGYNVQYSPYFDNKLAVASASNYGLVGNGRLSILDIAPNGQLIETKSFLTQ
DCLFDIAWNEQHEKQVVVAQGDGSLRLFDIDLAKYPIAIFNEHKKEVMSCNWNLINKTMF
TSSSWDGTVKIWSPTRKESLLTLRPTPKWKKHLDSMEPIIPKRRNNIQIQPSHKINMPNN
NNNKDCIYQSQFSPHDPNLLICCSGDSYTTIFDLRDPYNTQRNFLSHAGMEVLSADFNKY
RPNVLATAGVDNSIRIWDFRMLVARDAAICINEIVNAHDLAVRKVVWSPHHSDILLSTSY
DMSCKIWNDLSYDPIQQRKTGKTNSLDFTGNGCRFIMNQHTEFVFGADWSMWGQPGYVAS
TGWDGNVFIWNGLRG
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgctaaagtatcatatgcaagggttcagcgggtataatgtccaatactcgccttacttc
gataacaagctcgctgtagcatccgcatccaattatggtctagtgggaaatggccggtta
tccatccttgatatagcaccgaatggacaactcattgaaactaagtcattcttgacacaa
gattgtctctttgatatagcatggaatgaacagcatgaaaagcaagttgttgtagcacaa
ggtgacggatctttacggttgttcgacatcgatctggcgaaatacccaattgccatattc
aatgaacataagaaggaggtaatgagttgtaattggaatttaattaacaaaaccatgttt
acaagtagctcgtgggatggtactgtcaagatatggtcaccaacaagaaaggaaagtctg
ttaacgttacgacctacaccaaaatggaaaaaacaccttgattcaatggaaccaataata
ccgaaaagacgaaataatattcaaattcaaccatctcataagataaacatgcctaataat
aacaataataaggattgcatatatcagtcacaattttcacctcatgatccaaatttactc
atatgctgttcgggggattcatacacaacgatattcgatttaagggatccatataataca
caacgaaatttcctttctcatgcgggaatggaggtacttagtgcagatttcaataaatat
agacccaatgtattagccacagctggtgttgataatagtatccgtatttgggactttaga
atgttagttgctagggacgcagctatatgtattaatgaaatagtcaatgctcatgacttg
gctgtcagaaaagttgtttggtctcctcatcattcggatatcttactctccacttcatat
gatatgagttgtaagatctggaatgatttgagttatgatcctatacaacaacgaaaaact
ggaaaaaccaatagtctcgattttactgggaatggttgcaggtttattatgaaccagcat
actgaattcgtttttggagccgattggagtatgtggggccaaccgggatatgtcgcctca
acaggttgggatggtaacgtatttatatggaatggactaagaggttga

DBGET integrated database retrieval system