KEGG   Naumovozyma castellii: NCAS_0B06520Help
Entry
NCAS_0B06520      CDS       T02233                                 

Gene name
NCAS0B06520
Definition
(RefSeq) hypothetical protein
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
ncs  Naumovozyma castellii
Pathway
ncs00020  Citrate cycle (TCA cycle)
ncs00310  Lysine degradation
ncs00380  Tryptophan metabolism
ncs01100  Metabolic pathways
ncs01110  Biosynthesis of secondary metabolites
ncs01130  Biosynthesis of antibiotics
ncs01200  Carbon metabolism
Module
ncs_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ncs_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ncs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NCAS_0B06520 (NCAS0B06520)
  09105 Amino acid metabolism
   00310 Lysine degradation
    NCAS_0B06520 (NCAS0B06520)
   00380 Tryptophan metabolism
    NCAS_0B06520 (NCAS0B06520)
Enzymes [BR:ncs01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     NCAS_0B06520 (NCAS0B06520)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 11526030
NCBI-ProteinID: XP_003675107
UniProt: G0V9W9
LinkDB All DBs
Position
2:complement(1233059..1236085)
Genome map
AA seq 1008 aa AA seqDB search
MLRAISRPLYRHGSKSLIKSALLKQYASKVTATRCLTTGSDTFLSTSNSSYIDEMYQAWQ
KDPSSVHVSWDAYFKNMSNPKVAASNAFQAPPILVASLPGAPSAHLSNSMDENVSLHLKV
QLLCRAYQVRGHLKAHIDPLGLSFGDSKDKPVPPELTLDYYGFTEKDLDREIILGPGILP
RFAKNGKTTMKLRDIIADMESLYCSSYGIQYTHIPSKVKCEWLRERIEIPKPYEYTIDQK
RQILDRLTWATSFETFLSTKFPNEKRFGLEGLEAVVPGIKTLIDRSVELGVEDVVLGMAH
RGRLNVLSNVVRKPNESIFSEFQGTTTTNNIEGSGDVKYHLGMNYQRPTTSGKYVNLSLV
ANPSHLEAQDPVVLGRTRALLHAKGDLKNQTKALGVLLHGDAAFAGQGVVYETMGFQTLP
EYSTGGTIHVITNNQIGFTTDPRFARSTPYPSDIAKAIDAPIFHCNANDIEAVTFIFNLA
AEWRNEFHTDAIIDVVGWRKHGHNETDQPSFTQPLMYQKIAKQKSVIDEYTDKLIKEGSF
TKSDIDEHKKWVWGLFEKAFEKSKDYVPTQREWLTAAWEDFKSPKELATEILPHNPTNVS
VDIIQDIGKALSSWPENFEVHKNLKRILTNRGKSISTGEGIDWSTGEALAFGTLVLEGYN
VRVSGEDVERGTFSQRHAVLHDQKSEDTYVPLKHLSAKQADFSICNSSLSEYGVMGFEYG
YSLTSPDYLVMWEAQFGDFANTAQVITDQFIAGGEQKWKQRSGLVLSLPHGYDGQGPEHS
SGRLERFLQMANEDPRYFPSEEKLQRQHQDCNYQVVYPTTPANLFHIIRRQQHRQFRKPL
ILFFSKQLLRHPLARSQLEEFTEGGFQWIIEDVEHGRAIGTKEETKRLVLLSGQVYTALH
KKRETIGDKSTALMKIEELHPFPFAQLRDAIDSYPNLEEFVWCQEEPLNMGGWAYAAPRL
QTTLQETQNYKNHTVRYCGRNPSGAVAAGSKSLHIAEEEAFLKDVFGQ
NT seq 3027 nt NT seq  +upstreamnt  +downstreamnt
atgttaagagctatttctaggccattgtaccgccacggttctaaatcattaataaaatca
gctctgctcaaacagtatgcttcaaaagttaccgctacaagatgcttaacaactggttcg
gatacattcctatctacatcaaattcatcttatattgatgaaatgtatcaagcatggcag
aaagatccatcttcagttcatgtttcatgggatgcatatttcaaaaatatgagtaatcct
aaagtagctgcctctaatgcattccaagctcctcccattcttgttgcatcgctacctggt
gctccatctgctcatctctcaaatagtatggatgaaaatgtttccttacatttgaaagtt
caacttctatgcagagcctaccaagttagaggccatttgaaggctcacattgatccttta
ggtctttcattcggggatagtaaagataaacctgtgcctcctgaattaactttagattac
tacggtttcacagaaaaggatttggatagagaaattatcctaggtcctggtatcctacca
agatttgccaagaatggcaagactacaatgaaattgagagatattattgccgatatggaa
agcttgtattgttcttcttatgggatccaatatacccatattccatcaaaggtgaagtgt
gaatggttaagggaaagaattgagattccaaaaccttacgaatataccatagatcaaaag
agacaaattttggacagattgacctgggcaacttcttttgaaacattcttatctaccaag
ttccctaacgaaaagagatttgggctggaaggtttggaagctgttgttcctggtattaag
acattaatcgatcgttctgtggaactcggggtagaagatgttgtattaggtatggctcat
cgtggtagactaaacgttttatctaatgttgttcgtaagccaaatgaatccatcttttca
gaatttcaaggaactactacgaccaacaatattgaaggttctggtgatgttaagtatcat
ttaggtatgaactatcaaagaccaactacatcaggtaaatatgttaatttgtcattggta
gctaatccatctcatttagaggctcaagatcctgttgttcttggtagaactagagctcta
ttacatgctaaaggtgatctaaaaaatcaaactaaagcattgggtgtattgttacatggt
gatgcagcatttgctggacaaggtgttgtttatgaaaccatgggtttccaaactttacca
gaatattctacaggtggtaccattcatgttataacaaataatcaaattgggttcaccact
gatccaagatttgcaagatccacaccatatccatcggatattgccaaggctattgatgct
ccaatcttccactgtaatgcaaacgatattgaagcagttacatttatcttcaatttagca
gctgaatggaggaatgaattccatactgatgcaatcattgatgttgttggttggagaaag
catggacataatgaaactgatcaaccttcctttactcaaccattaatgtatcaaaaaatt
gctaagcagaaatctgttatcgatgaatatactgataaattaatcaaagagggatctttt
accaagagcgatattgacgaacacaagaaatgggtttggggtttatttgaaaaggcattt
gaaaaatccaaggattacgttccaactcaaagagaatggttgactgctgcttgggaagat
ttcaaatctccaaaggaattagctactgaaattttaccacataatccaactaacgtttcc
gttgatattatccaagacattggtaaagcattgtcttcatggccagaaaatttcgaagta
cacaagaatttaaagagaatcctaacaaatagaggtaaatcaatttctacaggtgaaggt
attgattggtctactggggaagccttagcctttggtactttagttcttgaaggttataat
gttagagtatctggggaagatgttgaaagaggtactttctctcaacgtcatgctgtatta
catgatcaaaaatcagaagatacatatgttccattgaagcatttaagtgccaagcaagct
gatttctctatttgtaactcttcattatctgaatatggtgtaatgggtttcgaatatggt
tattctttgacgtcaccagattacttagtcatgtgggaagctcaatttggtgattttgct
aatacagctcaagttattacagatcaatttattgctggtggtgaacaaaaatggaaacaa
agatcaggtttggttctttctttacctcatggttatgatggtcaaggtcctgaacattct
tctggtaggttagaaagattcttacaaatggctaacgaagacccaaggtatttcccatct
gaggagaaattacaaagacaacatcaagattgtaattatcaagttgtttacccaacaaca
ccagctaatttattccatatcataagaagacaacaacatcgtcaatttagaaaaccatta
atccttttcttctccaaacaactgttacgtcatccattggcaagatctcaattagaagag
tttactgaaggtggattccagtggatcattgaagatgttgaacatggtagggcaattggt
accaaggaagaaaccaagagattggtactattaagtggtcaagtttacacagcattacat
aagaagagagaaaccatcggtgataagagtacagctttaatgaagattgaagaattgcat
ccattcccatttgcccaattgagggacgctattgattcatatccaaacctagaggaattt
gtatggtgtcaagaagaacctctaaatatgggtggttgggcatacgccgcaccaagatta
caaactactttgcaagagactcagaactataagaatcatactgttaggtattgtggtaga
aacccaagcggtgctgttgctgctggttctaagagcttacatattgccgaagaagaagct
ttcctaaaggacgttttcgggcagtaa

DBGET integrated database retrieval system