KEGG   Naumovozyma castellii: NCAS_0C00660Help
Entry
NCAS_0C00660      CDS       T02233                                 

Gene name
NCAS0C00660
Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ncs  Naumovozyma castellii
Pathway
ncs00250  Alanine, aspartate and glutamate metabolism
ncs00410  beta-Alanine metabolism
ncs00430  Taurine and hypotaurine metabolism
ncs00650  Butanoate metabolism
ncs01100  Metabolic pathways
ncs01110  Biosynthesis of secondary metabolites
Module
ncs_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ncs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NCAS_0C00660 (NCAS0C00660)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NCAS_0C00660 (NCAS0C00660)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NCAS_0C00660 (NCAS0C00660)
   00430 Taurine and hypotaurine metabolism
    NCAS_0C00660 (NCAS0C00660)
Enzymes [BR:ncs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     NCAS_0C00660 (NCAS0C00660)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Vitelline_membr
Motif
Other DBs
NCBI-GeneID: 11528100
NCBI-ProteinID: XP_003675425
UniProt: G0VC49
LinkDB All DBs
Position
3:complement(104055..105833)
Genome map
AA seq 592 aa AA seqDB search
MLYKHTNNQKNPRTLYPKKEEQEERIAAQTTQTRKSIVGLEDVKLLSSQLQEMSYPGATT
TLEQSQTTLANSYVIPRHGLPEDVAYNLVHNELNLDGNPHLNLASFVNTTTTDIANKLIN
ENINKNLADNDEYPQLIELTQRCISMLAQLWKCSPDLEPIGCATTGSSEAIMLGGLAMKK
KWEHRMQDAGKDISKPNIIMSSACQVALEKFARYFEVECRLVPVSKKSHYMLDPKSLWDY
VDENTIGCFVILGTTYTGHLENVEKVADVLTEIENQNPTWSNKDIPIHVDGASGGFIVPL
SFHTDHMKQYGLQRWGFNHPRVVSINTSSHKFGLTTPGLGWVLWKDDSYLSNELRFRLKY
LGGIEETFGLNFSRPGFQVVHQYFNFVSMGLNGYKALFKKSIFVSRVFAHSLLTSKKMPG
YFDIVSSTHERISDGGIPDYVSDYWDNTQDYKPGIPLVAFKLSDEFHENFPEIPQAMISS
MLRSRGWIIPNYPLPKSTDDSDQCEVLRVVFRSEMKLDLAQMLLIDIEGIITKLLYSYTK
VSKEAQHMQATPESRRSFIYEMLLALASPEEGDTETNPELKERTSRNYRGTC
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgctttacaaacataccaacaaccagaagaacccaagaactctatatcccaagaaggag
gaacaggaggagcgcattgctgcgcagaccactcaaactcgtaagagtatagttggccta
gaagatgtcaaattgctctcatctcaattacaagaaatgtcctatcctggtgctaccaca
acgttggaacaatcccaaactactttggcaaacagttacgttatccccagacatgggtta
ccagaggatgtagcctataatttggttcataatgagttaaatttggacggtaaccctcac
ttaaatttagctagttttgttaacacgactacgaccgatattgctaataagttgattaat
gaaaatatcaataagaatctggcagataatgatgaatacccgcaattgattgaattgacg
caacgttgtatctctatgttggctcaattatggaaatgtagccctgatttggaaccaatt
ggatgtgccacaacggggtccagtgaagccattatgttaggtggtcttgcaatgaagaag
aaatgggaacataggatgcaagatgctggtaaggatatttccaaacccaacatcatcatg
agttctgcctgtcaagttgccttggaaaaatttgcaagatattttgaagtggaatgtaga
ttggttcctgtgtccaagaagtcccattatatgttggatcctaaatcgttatgggattac
gtggatgaaaatactattgggtgttttgtcattctgggtacgacttatactggtcatttg
gaaaatgttgagaaggtagccgatgttctaacggagattgaaaatcaaaatccaacatgg
agcaataaagatattccaattcatgtcgatggtgcatctggtgggtttattgttcccttg
tccttccatacagaccatatgaaacaatacggattacaacgttgggggttcaaccatcca
cgtgtggtaagtattaacacaagtagtcataaattcgggttaaccacacctgggttaggt
tgggttctatggaaggatgattcgtacctttcaaatgaattaagattcagattgaaatat
ttaggtggtattgaagagacctttggtttaaatttttccagacctgggttccaagttgtt
caccaatatttcaattttgtttcaatgggattgaatggttataaggcattattcaagaaa
tctatatttgtttccagagtatttgctcatagtttacttacaagtaagaagatgcccgga
tattttgacattgttagtagtactcatgaacgtatttctgatggtgggatcccagactat
gtttcagactattgggacaatacacaagactataaacctggtatccctctagttgccttc
aaattatccgatgaattccatgaaaatttcccagaaattccacaggccatgatttcatca
atgttaagaagcagaggatggatcatccccaattatccactaccaaaatctacagatgac
tctgaccaatgcgaagtgttaagggtggtcttcagaagtgaaatgaagttagatttggca
caaatgttgctcattgacattgaaggcatcattactaaattgctgtatagctacacaaag
gtgtccaaggaagcgcaacacatgcaagccacaccggagagcagacgttctttcatttac
gagatgttactagcattagcgtcgccagaagagggcgacacggaaacaaacccggagttg
aaggaaagaacctccaggaactacagaggtacctgctaa

DBGET integrated database retrieval system