KEGG   Naumovozyma castellii: NCAS_0C04320Help
Entry
NCAS_0C04320      CDS       T02233                                 

Gene name
NCAS0C04320
Definition
(RefSeq) hypothetical protein
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
ncs  Naumovozyma castellii
Pathway
ncs04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:ncs00001]
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    NCAS_0C04320 (NCAS0C04320)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ncs03036]
    NCAS_0C04320 (NCAS0C04320)
Enzymes [BR:ncs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     NCAS_0C04320 (NCAS0C04320)
Chromosome and associated proteins [BR:ncs03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     NCAS_0C04320 (NCAS0C04320)
   HDAC complexes
    Sin3A-HDAC complex
     NCAS_0C04320 (NCAS0C04320)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    NCAS_0C04320 (NCAS0C04320)
  Chromatin remodeling factors
   NuRD complex
    NCAS_0C04320 (NCAS0C04320)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 11527816
NCBI-ProteinID: XP_003675786
UniProt: G0VD60
LinkDB All DBs
Position
3:887622..888926
Genome map
AA seq 434 aa AA seqDB search
MVYENKPFDPITIKSSDTKKRVAYFYDADVGNYAYGSGHPMKPHRIRMTHSLVMNYGLYK
KMEIYRAKPATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEY
CSISGGGSMEGAARLNRGKCDVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRFHPR
VLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKYGEFFPGTGELRDTGVGKGKYYAVNVPLR
DGIDDATYRNVFEPVIKRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVNYVK
SFGIPMMVVGGGGYTMRNVARTWCFETGLLNNVVLDQELPYNDYYEYYGPDYKLDVRPSN
MFNVNSSEYLDKIMTSIFTNLENTKYAPSVELTNVPKDPEDLGDQEEDTAEAKDTKGGSQ
YARDQEVEHPNEFY
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggtgtatgagaacaaaccatttgacccgataacgatcaaatcttcagacacgaagaaa
cgagtcgcctatttctatgacgccgacgtgggtaattacgcttacggttcagggcacccg
atgaaaccacacaggataagaatgacccactccttggtgatgaactacggtctatataag
aaaatggaaatttacagagctaaaccagccacgaaacaggaaatgtgtcaatttcacacc
gatgaatatatcgatttcctgtctagggtgactcccgacaatttggagatgttcaagaag
gaaagtgtcaagtttaatgtcggggatgattgtcccgtgttcgatgggctttacgaatat
tgtagtatctctggtggaggatccatggagggggccgcaagattgaatagaggtaaatgt
gacgtggctattaattacgcaggtgggttgcatcatgctaagaaatcagaagcctctggg
ttttgctacctgaacgatatcgtcttggggatcattgaactattaaggtttcatccaaga
gtactttacatcgatatcgatgtccatcatggggacggtgtagaggaggcattttatacc
acagatcgtgtgatgacttgttcattccacaagtatggtgagtttttccccgggactggg
gaattgagagatactggtgtcggtaaggggaaatactacgctgttaacgtgcccctaaga
gatggtattgatgatgccacgtatagaaacgtatttgaacccgtaataaagagaattatg
gaatggtatcaaccttccgctgttgtattacaatgtggtggtgattccctatcaggggat
cgtctcggttgtttcaatctttccatgcaaggtcacgctaattgtgtcaattacgtgaaa
tcctttggtatccccatgatggtggtcggtggtggtggttacacaatgagaaatgtggct
agaacttggtgtttcgaaacagggttgttgaacaatgttgtcttggatcaagaactacca
tataatgattattatgaatattatggaccagattataaattagacgttagaccatcaaac
atgtttaatgtcaattccagtgaatatctagataaaataatgacctccattttcacgaat
ttggaaaatactaagtatgcaccaagtgttgagttgactaacgtgcccaaggaccctgaa
gatctcggagaccaggaggaggataccgctgaggccaaggacacgaagggtgggtcacag
tatgcaagagaccaagaagtagagcacccaaacgagttttattga

DBGET integrated database retrieval system