KEGG   Naumovozyma castellii: NCAS_0F00460Help
Entry
NCAS_0F00460      CDS       T02233                                 

Gene name
NCAS0F00460
Definition
(RefSeq) hypothetical protein
  KO
K02358  elongation factor Tu
Organism
ncs  Naumovozyma castellii
Brite
Translation factors [BR:ncs03012]
 Eukaryotic Type
  Elongation factors
   NCAS_0F00460 (NCAS0F00460)
 Prokaryotic Type
   NCAS_0F00460 (NCAS0F00460)
Mitochondrial biogenesis [BR:ncs03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    NCAS_0F00460 (NCAS0F00460)
Exosome [BR:ncs04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NCAS_0F00460 (NCAS0F00460)
  Exosomal proteins of breast cancer cells
   NCAS_0F00460 (NCAS0F00460)
  Exosomal proteins of colorectal cancer cells
   NCAS_0F00460 (NCAS0F00460)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-GeneID: 11527268
NCBI-ProteinID: XP_003676886
UniProt: G0VGB0
LinkDB All DBs
Position
6:80422..81918
Genome map
AA seq 498 aa AA seqDB search
MRPSFLYILFLTFLFSRFIGSQSAVTRPSDFKEISYITCIPSFTRITITTTIAFKQASNQ
LIMSVLAIPRLTLPRMLPSVVRSSAAFIATRRSMATATTHAAFNREKPHVNVGTIGHVDH
GKTTLTAAITKCLAKEGSAQFLDYNAIDKAPEERARGITISTAHVEYETKKRHYSHVDCP
GHADYIKNMITGAAQMDGAIIVVAATDGQMPQTREHLLLARQVGVQKIVVFVNKVDTIDD
PEMLELVEMEMRELLTQYGFDGENAPIIMGSALCALEGRQPEIGEKAIMKLLDAVDEYIP
TPERDLVKPFLLPIEDIFSISGRGTVVTGRVERGHLKRGEELEIVGYNKTPLKTTVTGIE
MFRKELDEAMAGDNAGILLRGIRRDQLKRGMVLAKPGTVNAHTKILASMYILSKEEGGRH
SGFGENYRPQMFIRTADVTAVMKFPPEVEDHSKQVMPGDNVEMECELVHPTPVEVGQRFN
IREGGKTVGTGLVTRIIE
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgagaccatccttcctttatattctattcctcacttttctgttctcgcgtttcattggt
tctcaaagcgcggttacccggccatcggattttaaggaaatctcatatataacatgtata
ccctcttttacacgtattacaatcactacaacaatagcattcaagcaagcaagcaatcag
ttaatcatgtccgtgctagccatacccagacttacactgccaaggatgttgccctccgtg
gttcgttcttctgccgcctttattgctaccagaagatctatggccaccgccaccacacac
gctgccttcaacagagagaaaccacacgtcaacgtaggtaccatcggtcatgtggatcat
gggaaaaccactttgactgcagcaattaccaagtgtctcgccaaagaggggtcagcgcaa
tttctagactataacgccatcgataaggctcccgaggaaagagctagagggatcacgatc
tcaacggctcatgtcgagtacgagaccaagaagagacattattcacatgtcgattgtccg
ggccatgcggattatattaagaatatgatcaccggtgccgctcagatggatggggccatt
attgttgtcgccgccacggatggtcaaatgcctcaaacgagagaacatttactattggct
agacaagttggtgtgcaaaaaattgttgtgtttgttaataaggttgataccattgatgac
ccagaaatgttggaattggtagaaatggaaatgagagaattgttgacacagtatgggttt
gatggtgagaatgcaccaattattatgggttctgcattgtgcgccctagaggggagacaa
ccagaaattggtgaaaaggcaattatgaaattattggacgccgtggatgaatatattcca
actccagaaagagatttagtgaaaccattcctattacctattgaagatattttttccatc
tcagggagaggtactgtggtgacaggtcgtgtcgagagaggtcatttgaaaagaggtgaa
gaattggaaattgtaggttacaacaagactcccctaaagactactgtcacagggattgaa
atgtttagaaaggaattggatgaagccatggctggtgataacgcaggtatcttattaaga
ggtattagaagagatcaattgaaaagaggaatggtcttggctaagccaggtaccgtgaat
gctcataccaagattctggcctccatgtacattctttccaaagaggaaggtggtagacat
tcaggatttggtgaaaattatagacctcaaatgttcattagaactgctgatgtcactgca
gtgatgaaatttccaccagaagtggaagatcactccaagcaagtcatgcccggtgataat
gtcgagatggaatgtgaattggttcatccaaccccagtggaagtgggtcaacgtttcaat
attagagaaggtggtaagactgtagggacaggtttagtcactcgtatcattgaatga

DBGET integrated database retrieval system