KEGG   Naumovozyma castellii: NCAS_0F02320Help
Entry
NCAS_0F02320      CDS       T02233                                 

Gene name
NCAS0F02320
Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ncs  Naumovozyma castellii
Pathway
ncs00020  Citrate cycle (TCA cycle)
ncs00190  Oxidative phosphorylation
ncs01100  Metabolic pathways
ncs01110  Biosynthesis of secondary metabolites
ncs01130  Biosynthesis of antibiotics
ncs01200  Carbon metabolism
Module
ncs_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ncs_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ncs_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ncs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NCAS_0F02320 (NCAS0F02320)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NCAS_0F02320 (NCAS0F02320)
Enzymes [BR:ncs01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     NCAS_0F02320 (NCAS0F02320)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA FAD_binding_3 DAO
Motif
Other DBs
NCBI-GeneID: 11527558
NCBI-ProteinID: XP_003677071
UniProt: G0VGU5
LinkDB All DBs
Position
6:461457..463499
Genome map
AA seq 680 aa AA seqDB search
MLYRFSALSVFMDYLVYIHTYKHIPYWQPQRLDSTIQSILATSPIMLSLKNRVSSRLPAW
VAQTSRRTLASAASATEFKSPFGKDYNIIDHEYDCVVVGAGGAGLRATFGLAEAGFKTAC
ISKLFPTRSHTVAAQGGINAALGNMHPDDWKWHMYDTVKGSDWLGDQDSIHYMTREAPNS
IIELEHYGMPFSRTEEGKIYQRAFGGQTKEYGKGEQAYRTCAVADRTGHAMLHTLYGQAL
RHDTHFFIEFFALDLLTHDGEVVGVIAYNQEDGTIHRFRAHRTVMATGGYGRAYFSCTSA
HTCTGDGNAMVSRAGFPLQDLEFVQFHPSGIYGSGCLITEGARGEGGFLVNSEGERFMER
YAPTAKDLACRDVVSRAITMEIRAGRGVGPEKDHMFLQLSHLPPSVLQERLPGISETAAI
FAGVDVTKEPIPILPTVHYNMGGIPTKWTGEALTIDEETGEDKVIPGLMACGEAACVSVH
GANRLGANSLLDLVVFGRAVAHTVADTLQPNTPHKPVPMDIGKESIANLDKIRNANGSRS
THEISMKMKKTMQKDVSVFRTQESLDEGVSNITAVDNSFKDVKISDRSMIWNSDLVETLE
LQNLLTCATQTAVSAANRKESRGAHAREDYPNRDDENWMKHTLSWQKDTGAPVELKYRNV
ISHTLDEKECPSVPPTVRSY
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgctttaccgcttctccgcgctttcggtctttatggactatctggtatatatacacaca
tacaagcacataccctactggcaaccacaacgactcgattccaccattcaatcaatactc
gcaactagtccaatcatgctatcactcaagaacagggtctcgtctcgactccccgcctgg
gtcgctcagacctccaggagaacactcgcctccgcagcatctgctacagaattcaagtcc
cccttcggcaaggactacaacatcatcgatcatgaatacgactgtgtcgtcgtcggtgct
ggtggtgctgggcttcgtgccacttttgggctggctgaagcaggtttcaaaaccgcttgt
atctccaaattgttccccactagatctcatacggtcgccgcccagggggggatcaatgct
gccttggggaatatgcatccagatgactggaaatggcacatgtatgacaccgtcaagggc
tccgactggctcggagaccaggattcaatccattacatgacgagagaggctccaaactcc
attatcgagttggaacactatgggatgcccttctcgagaacagaggaagggaagatctac
caacgtgcgtttgggggtcaaactaaggaatacgggaagggagaacaggcctatagaacc
tgtgccgtcgctgatagaacgggacatgccatgttacatactttgtacgggcaggcttta
agacacgatactcatttctttattgagttttttgccctagatttgttgactcacgacggg
gaagtcgttggtgttattgcttataaccaagaggatgggaccattcatagatttagagct
cataggaccgtcatggccacgggtggatatgggagagcttatttctcatgtacttcagct
catacttgtactggggatggtaatgccatggtttcacgtgctggattccccttacaagat
ttggaatttgttcaatttcatccatcagggatttatggatcaggttgtttgattaccgag
ggtgctcgtggtgaaggtgggtttttagttaactctgaaggtgaaagatttatggaacgt
tatgcccccacagcaaaggatctggcatgtagagatgtcgtttcaagagccatcaccatg
gaaattagagcaggaagaggtgttggaccagaaaaggatcacatgtttttacaattgagc
catttaccaccttccgtcttgcaagagagattaccaggtatctctgaaactgcagccatc
tttgcaggtgtcgatgttaccaaggaaccaattccaatcttaccaaccgttcattataac
atgggtggtatccccaccaaatggacaggggaagcattaaccatagatgaagaaactggt
gaagataaagttattccagggttaatggcatgtggtgaagcagcttgtgtttcagtgcat
ggtgctaatagattaggtgctaactcactattagatttagttgtctttggacgtgctgtc
gctcataccgtcgctgatactttacaaccaaatactccacataaacctgtccctatggat
atcggtaaggaatccatcgccaatttagacaagattagaaacgctaatggatccagatct
actcacgaaatcagtatgaagatgaaaaagacaatgcaaaaggatgtctctgtgtttaga
actcaagagagtttggatgaaggtgtcagtaacattactgctgtggataattcattcaag
gatgtcaagatctcagatagatccatgatttggaactctgatttggtggaaactttagaa
ttacaaaacttgttgacttgtgccactcaaactgctgtctctgctgccaatagaaaggaa
tctcgtggtgctcatgcaagagaagattatccaaatagagatgatgaaaactggatgaaa
cacacgttgtcatggcaaaaggacactggtgctccagtggaattgaaatacagaaatgtc
atttctcatactttagatgaaaaggaatgtccctctgtaccaccaaccgtcagatcttac
tag

DBGET integrated database retrieval system