KEGG   Naumovozyma castellii: NCAS_0F04080Help
Entry
NCAS_0F04080      CDS       T02233                                 

Gene name
NCAS0F04080
Definition
(RefSeq) hypothetical protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
ncs  Naumovozyma castellii
Pathway
ncs00010  Glycolysis / Gluconeogenesis
ncs00051  Fructose and mannose metabolism
ncs00052  Galactose metabolism
ncs00500  Starch and sucrose metabolism
ncs00520  Amino sugar and nucleotide sugar metabolism
ncs01100  Metabolic pathways
ncs01110  Biosynthesis of secondary metabolites
ncs01130  Biosynthesis of antibiotics
ncs01200  Carbon metabolism
Module
ncs_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ncs_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCAS_0F04080 (NCAS0F04080)
   00051 Fructose and mannose metabolism
    NCAS_0F04080 (NCAS0F04080)
   00052 Galactose metabolism
    NCAS_0F04080 (NCAS0F04080)
   00500 Starch and sucrose metabolism
    NCAS_0F04080 (NCAS0F04080)
   00520 Amino sugar and nucleotide sugar metabolism
    NCAS_0F04080 (NCAS0F04080)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    NCAS_0F04080 (NCAS0F04080)
Enzymes [BR:ncs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     NCAS_0F04080 (NCAS0F04080)
Membrane trafficking [BR:ncs04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    NCAS_0F04080 (NCAS0F04080)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 FGGY_N DUF2294
Motif
Other DBs
NCBI-GeneID: 11527670
NCBI-ProteinID: XP_003677245
UniProt: G0VHB9
LinkDB All DBs
Position
6:814117..815577
Genome map
AA seq 486 aa AA seqDB search
MVHLGPKKPPARKGSMADVPQELLNKLQELEQMFTVSAETSRAVVKHFISELDKGLSKQG
GNIPMIPGWVVEYPTGKESGDYLAIDLGGTNLRVVLIKLGGDRTFDTTQSKYKIPDGMRT
TQNPDELFEFIADSLAAFLEEIYPEGVTKNLPLGFTFSYPASQDKINEGILQRWTKGFDI
PGVEGHDVVQMLQKQLDKKKIPIDLVALINDTTGTLVASLYTDGETKMGVIFGTGVNGAY
YDKVSDIPKLEGKLADDIPGSSVMAINCEYGSFDNEHSVLPRTKYDVQIDEESPRPGQQA
FEKMTSGYYLGELLRLAVLDLQSQGLILKGQDMTKLQVPYVMDTSYPARIEEDPFENLED
TDSLLQKEFNIKTTVQERKLIRRLCEVIGIRAAELAVCGIAAICQKRGYETGHIAADGSV
YKMYPGFPEKAAEGLRKIYGWKPAPMDQYPLQIVASEDGSGTGAAIIAALTEKRLAAGKS
VGIIGA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggttcatttaggtccaaagaaaccacctgccagaaagggatccatggctgatgtccca
caagaattgttaaacaaattgcaagaactagaacaaatgttcactgtctctgctgaaact
tccagagccgttgttaagcatttcatctccgaattagacaagggtttatccaagcaaggg
ggtaacattccaatgattccaggttgggtcgttgaatatccaactggtaaggaatccggt
gattatttggctatcgatttgggtggaaccaacttgagagttgtcttgatcaagttgggt
ggtgaccgtacatttgacactactcaatccaaatataagattccagatggaatgagaact
actcaaaaccctgatgaattgttcgaattcattgctgattccttagctgccttcttagaa
gaaatttacccagaaggtgtcactaagaacttaccattaggtttcactttctcctaccca
gcatctcaagataagattaatgaaggtatcttacaaagatggaccaagggtttcgatatc
ccaggtgttgagggtcatgatgttgttcaaatgttacaaaagcaattagacaagaagaag
atcccaattgatttggtcgctttaattaacgataccaccggtactttggttgcctctttg
tatactgatggtgaaaccaagatgggtgttatcttcggtactggtgtcaacggtgcttac
tacgataaggtttctgacattccaaagttggaaggtaagttggctgatgatattccaggt
tcttctgttatggccattaattgtgaatatggttctttcgacaatgaacattctgtttta
ccaagaaccaaatacgacgtccaaattgatgaagaatctccaagaccaggccaacaagct
ttcgaaaagatgacttccggttattacttgggtgaacttttacgtttagctgtcctcgat
ttacaaagccaaggtttgatcctaaagggtcaagatatgaccaaattgcaagttccatac
gtcatggatacctcctacccagccagaattgaagaagatccatttgaaaacttggaagac
actgactctttgttacaaaaggaattcaatatcaagactactgttcaagaacgtaaattg
attagaagactatgtgaagtcatcggtatcagagctgctgaattagctgtctgtggtatt
gctgccatctgtcaaaagagaggttacgaaactggccatattgctgctgatggttctgtt
tacaagatgtacccaggtttcccagaaaaggctgctgaaggtttgagaaagatctacggt
tggaaaccagctccaatggaccaatacccattacaaattgtcgcctctgaagatggttct
ggtactggtgccgctatcattgctgcattgactgaaaaaagattggctgctggtaagtct
gttggtatcattggtgcttaa

DBGET integrated database retrieval system