KEGG   Naumovozyma castellii: NCAS_0G01260Help
Entry
NCAS_0G01260      CDS       T02233                                 

Gene name
NCAS0G01260
Definition
(RefSeq) hypothetical protein
  KO
K00667  fatty acid synthase subunit alpha, fungi type [EC:2.3.1.86]
Organism
ncs  Naumovozyma castellii
Pathway
ncs00061  Fatty acid biosynthesis
ncs01100  Metabolic pathways
ncs01212  Fatty acid metabolism
Module
ncs_M00082  Fatty acid biosynthesis, initiation
ncs_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ncs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NCAS_0G01260 (NCAS0G01260)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ncs01004]
    NCAS_0G01260 (NCAS0G01260)
Enzymes [BR:ncs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.86  fatty-acyl-CoA synthase system
     NCAS_0G01260 (NCAS0G01260)
Lipid biosynthesis proteins [BR:ncs01004]
 Fatty acid synthase
  Yeast type
   NCAS_0G01260 (NCAS0G01260)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fas_alpha_ACP FAS_I_H ketoacyl-synt ACPS Ketoacyl-synt_C Phage_RpbA
Motif
Other DBs
NCBI-GeneID: 11528683
NCBI-ProteinID: XP_003677366
UniProt: G0VHX9
LinkDB All DBs
Position
7:222367..228039
Genome map
AA seq 1890 aa AA seqDB search
MVMKPEVEQELAHVLLTELLAYQFASPVRWIETQDVFLKDMNTERVVEIGPSPTLSGMAQ
RTLKNKYESYDAALSLQRQILCYSKDAKEIYYTPDPVAEAPEEETKATEAPAAAAAPAPA
PVAAAAPVAVAAPAPSAAAAELPDAPVKASLLLHVLVAHKLKKSLDSIPMSKTIKDLVGG
KSTVQNEILGDLGKEFGSTPEKPEDTPLEELAETFQDTFSGSLGKQSTSLISRLISSKMP
GGFTITVARKYLQSRWGLPSGRQDSTLLVALSNEPAARLASEADAKSFLDGQAQKYASIA
GVDLSAASAPAAASGAGSAGGATIDAAALDELNKDHQVLARQQLQVLARYLKMDLDGGER
KFLKEKDTVKNLQAQLDFLTEELGEFYVGALNTAFSRKKARVFDSSWNWAKQSLLHLYFE
IIHGVLKNIDREVVSEAINIMNRSNDALIKFMEYHINNTDETKGENYKLVKDLGEQLIEN
CKLALDLDPVYKDISKPTGPKTVIDKNGNIKYSEEPREKVRKLSQYIQEMALGGPLSKAP
GTTIQEDLTRVYKAISAQASTHEISDSTKLEFEKIYGDLMQFLTNSKEIDASQTTQLAGG
EDEDDDLDKDSTKEVASLSNKSTISKSVSSTVPRETVPFLHLKKKSSSGAWKYDRHSSAL
FLDGLEKAAVNGVTYKDKYVLLTGAGNGSIGGEILRGLLQGGAKVIATTIGINKANMEYF
QSVYAKFGAKGSTLVVVPFNQGSKQDVEALINYIYDDEKAGGLGWDLDAIIPFAAIPENG
IELDNIDSKSEFAHRIMLTNIFRIMGNVKKQKSAKGIETRPAQVILPMSPNHGTFGGDGL
YSESKLSLETLFNRWFSESWGNQLTICGAIIGWTRGTGLMSGNNIIAEGIEKMGVRTFSQ
KEMAFNLLGLLTPEVVQLSQKAPVMADLNGGLQFLKDLKEFTRKLRTDLTETSEIRKAVS
IETALEHKTVNGDNADAAYAQVEIQPRANIQLNFPTLKSYKDIKATAAPELEGLLDLERV
IVVTGFSEVGPWGSSRTRWEMESSGEFSLEGCVEMAWMMGLIKYHNGNLKGRPYTGWVDA
KTNEPIDDKDVKSKYESHILDHAGIRLIEPELFNGYNPERKHMIQEIIVEENMEPFEASK
ETAEQFKHEHGDKVDIFEIPETGEYSVKLLKGATLYIPKALRFDRLVAGQIPTGWNAKTY
GISDDVISQVDPITLFVLVSVVEAFIASGITDPYEMYQYVHVSEVGNCSGSGMGGVSALR
GMFKERYKDEPVQNDILQESFINTMSAWVNMLLISSSGPIKTPVGACATSVESVDIGVET
ILSGKAKICIVGGYDDFQEEGSYEFGNMKATSNTLEEFEHGRTPSEMSRPATSTRNGFME
AQGAGIQIIMNADLALKMGVPIYGIVALTATATDKIGRSVPAPGKGILTTAREHHGDLKF
PTPLLNIKYRKRQLAAREVQIKQWVENEIDLLKYEVSEVPLDDQEEFFVERTKEINHEAS
KQLKAAQSQWGNEFFKNEPRIAPLRGALATYGLTIDDLGVASFHGTSTMANDKNESATLN
DMMKHLGRSEGNPVVGVFQKFLTGHPKGAAGAWMMNGALQILNTSIIPGNRNADNIDKLL
EQYEYVLFPSKSLKTNGIKAVSITSFGFGQKGAQAIVVHPDYLYAAIDESKYNEYKSKVN
KREKTAYKYFHNGMITNKLFVSKEHAPYSDELEESVYLDPLARVSQDKKDGSLTFNSGSI
QNKNTYASASNRETAAIVRELTKEVANTKTNVGVDVELITSINVENETFIERNFTASEIA
YCSQQPSVQSSYAGTWSAKEAVFKSLGVQSRGAGASLKEIEISRVHGNAPVVVLHGDAKK
IATGAGIVEVNVSISHDDFQSIAVAISTKK
NT seq 5673 nt NT seq  +upstreamnt  +downstreamnt
atggttatgaaaccagaagttgaacaagaattggctcatgtccttttgacagagcttcta
gcttatcaattcgcatctccagtgagatggattgaaactcaagacgtcttcttgaaagat
atgaacacagaaagagtcgtcgaaatcggtccatccccaactttgtcagggatggctcaa
agaactttgaagaataagtacgaatcatatgatgctgctttatctttgcaaagacaaatc
ttatgttactctaaggacgccaaggaaatttactacactcctgacccagtcgctgaagct
ccagaggaagaaactaaagccactgaagctcctgccgccgctgctgctccagctccagct
ccggttgccgctgccgctccagttgccgtcgctgccccagccccatcagctgctgctgcc
gaactacctgatgctcctgttaaggcttccttattgttgcacgtcttagtcgctcataaa
ttaaagaaatcactggactctattccaatgtcaaagaccattaaagatttggttggtggt
aaatctactgtgcaaaatgaaattcttggtgatttaggtaaggaattcggatctacacca
gaaaagccagaagacactccacttgaagaattggctgaaactttccaagacacattttcc
ggttctttaggtaagcaatccacctctctaatctcaagattaatttcttctaagatgcct
ggtgggttcaccatcactgttgctagaaagtacttgcaatctcgttggggtttaccttcc
ggtagacaagattctactttgttagtagctttgtccaatgaaccagctgctcgtcttgcc
tcggaagctgatgcaaagagcttcttagatggacaagctcaaaagtacgcctctattgca
ggtgtagatttatctgctgcttctgctcctgctgcagccagtggagcaggcagtgctggt
ggtgccactatcgatgctgctgcattggatgaattgaacaaggatcaccaagttctagct
cgtcaacaattgcaagtcttggctcgttatttaaagatggatctagatggtggtgaaaga
aagttcctaaaagagaaagataccgtcaaaaatttacaagctcagttagatttcttaact
gaagaattaggtgaattctacgtcggtgctttgaatactgccttttcaagaaagaaggcc
agagtttttgactcatcttggaattgggctaagcagtcattgctacacttgtatttcgaa
atcatccatggtgtcttgaagaacattgatagagaagtggtgagtgaagccattaatatc
atgaatagatccaatgatgccttgatcaagttcatggaatatcatatcaataacactgac
gaaactaagggtgaaaattacaaattagtcaaagatttgggtgaacaattaattgaaaat
tgtaaattggcccttgacttagaccctgtgtacaaggatatctctaaaccaactggtcca
aagactgttattgacaagaatggtaacattaagtactctgaagaaccaagagaaaaggtg
agaaaactatcccaatacattcaagaaatggctctaggtggtccattaagtaaggctcca
ggaactaccattcaagaagatttgacccgtgtttacaaggccattagtgcacaagcttca
acccatgaaatctctgactctaccaaattggaattcgaaaagatttacggtgatttgatg
caattcttaaccaactccaaggaaatcgatgcatctcaaactactcaattagccggtggc
gaagatgaagacgatgatttagataaggattccaccaaggaagttgcatcattatcaaac
aaatccaccatttctaagagtgtctcctctactgttccaagagaaacagttcctttctta
catttgaagaagaagtcatcaagtggtgcatggaagtacgatcgtcattcttctgctcta
ttcttagatgggttggaaaaggctgccgttaacggtgttacttacaaggataaatatgtc
ttgcttactggtgccggtaacggttccattggtggtgaaattttaagaggtttactacaa
ggtggtgccaaggttattgctactactattggtattaacaaggcaaacatggaatatttc
caatcagtttatgctaagtttggtgccaagggttccactttagttgttgttccattcaac
caaggttccaagcaagatgtggaagctttaatcaactatatttacgatgatgaaaaggcc
ggtggtttaggttgggatttggatgccattattccatttgctgccattccagaaaacggt
attgaattagacaatattgattccaaatctgaatttgctcacagaattatgttgaccaat
atctttagaatcatgggtaacgtcaagaaacaaaaatctgctaagggtattgaaactaga
cctgcccaagtcatcttaccaatgtctccaaaccatggtacttttggtggtgatggtttg
tattctgaatccaaattatctttggaaacattattcaacagatggttctctgaatcctgg
ggtaaccaattaaccatttgtggtgccattattggttggaccagaggtactggtttaatg
agtggtaataacattattgctgaaggtattgaaaagatgggtgtccgtactttctctcaa
aaggaaatggcctttaacttattaggtttattgactcctgaagttgttcaattgtcacaa
aaggcacctgttatggctgatttgaatggtgggttacaattcttgaaagatttgaaagag
ttcactcgtaaattacgtactgatttgactgaaacttctgaaattagaaaggctgtttcc
attgaaactgcattggaacacaagacagttaatggtgataatgctgatgctgcatatgct
caagtggaaattcaaccaagagccaatattcaattaaatttcccaactttgaaatcatac
aaggatattaaagctactgcagcacctgaactggaaggtttattagatttggaaagagtc
attgtggttactggtttctctgaagttggtccatgggggtcttccagaactagatgggaa
atggaatcatctggtgaattctcattggaaggttgtgtggaaatggcttggatgatgggg
ttgattaagtatcataatggtaatttgaaaggtcgtccatacactggttgggttgatgct
aagaccaatgaacctattgatgataaggatgttaagagtaaatacgaaagtcatatcctt
gaccatgctggtattagattaattgaacctgaattgtttaatggttacaacccagaaaga
aagcatatgattcaagaaattattgttgaggaaaacatggaaccatttgaagcttctaaa
gaaacagctgaacaattcaagcatgagcatggtgataaagtggacatttttgaaatccct
gaaactggtgaatattctgttaaattattaaagggtgccactttatacattccaaaggcc
ttgagatttgatcgtcttgtggctggtcaaattccaactggttggaacgctaagacttat
ggtatctctgatgatgttatttctcaagtggatccaattactttgtttgtcttagtttcc
gtggtggaagcatttattgcgtctggtattactgatccatatgaaatgtaccaatacgtc
catgtttctgaagtgggtaactgttccggttccggtatgggtggtgtttccgcattacgt
ggtatgtttaaggaacgttataaggatgaacctgttcaaaatgatatcttacaagaatcg
ttcattaacacgatgtcagcctgggtcaatatgttattaatttcttccagtggtccaatt
aagacccctgtgggtgcctgtgccacatctgtggaatctgttgatattggtgtggaaacc
atcctatctggtaaggctaagatttgtattgttggtggttatgatgattttcaagaagaa
ggttcatatgaatttggtaacatgaaggctacttctaacacgttggaagaatttgaacat
ggtcgaaccccctctgagatgtctagacctgctacatcgactcgtaacgggttcatggaa
gcacaaggtgctggtattcaaatcattatgaatgctgatttggctttgaagatgggtgtt
ccaatttatggtattgttgccttgaccgcgactgctactgataagattggtagatctgtt
ccagctccaggtaagggtatcttaacgacagccagggagcatcatggtgatttgaaattc
cccactccattattgaatattaagtataggaaacgtcaattggctgctcgtgaggttcaa
attaagcaatgggtggagaatgaaattgatcttttgaaatatgaagtcagtgaagttcca
ttggatgatcaagaggaattcttcgtggaacgtaccaaggagatcaaccatgaggcatcc
aagcaattgaaggcagcccaaagtcaatgggggaatgaattctttaagaatgaaccacgt
attgctccattgagaggtgcgttggccacgtatgggttaaccattgatgatttaggagtg
gcttcattccatggtacttccactatggccaatgataagaatgaatccgccactttgaat
gatatgatgaaacatttaggtagatctgaggggaaccccgttgttggtgttttccaaaaa
ttcttaactggtcatcctaagggtgctgctggtgcttggatgatgaatggtgccttacaa
attttgaatactagtattattccagggaataggaatgcggacaatattgataaattgttg
gaacaatacgaatatgtgttattcccctccaagtctttgaagaccaatggtatcaaggcc
gtttccattacctcgtttgggtttggtcaaaagggtgcccaggctattgttgttcatcca
gattatctatatgctgccattgatgaatccaaatacaatgaatataagagcaaggttaac
aagagagagaagactgcatacaagtacttccataatggtatgatcactaacaagttattt
gtcagtaaagagcatgcgccatacagtgatgaattggaggagtcagtctatttggatcca
ttagcgcgtgtttctcaggacaagaaggacggtagtttaacgttcaacagtggatcgatc
caaaacaagaacacttatgcgtctgcatccaacagggagaccgcagccatcgtgagagaa
ttgaccaaggaagtagctaataccaagacgaatgttggagtggacgtggagttgattacg
agtatcaatgtggaaaacgaaacattcattgaacgcaatttcaccgccagcgagatcgca
tactgttcccagcaaccaagtgtgcagagttcgtatgccgggacatggtccgccaaggaa
gcagttttcaagtccttgggagtgcagtcacggggcgcgggagcgtctctgaaagagatt
gaaatttcccgtgttcatggaaacgcgcccgttgtagtgttgcacggagatgctaagaag
attgctacgggtgcgggcattgtggaggtgaacgtttccatctcacacgacgacttccag
tccattgccgttgcgatctccactaagaagtaa

DBGET integrated database retrieval system