KEGG   Naumovozyma castellii: NCAS_0G03900Help
Entry
NCAS_0G03900      CDS       T02233                                 

Gene name
NCAS0G03900
Definition
(RefSeq) hypothetical protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
ncs  Naumovozyma castellii
Pathway
ncs00500  Starch and sucrose metabolism
ncs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NCAS_0G03900 (NCAS0G03900)
Enzymes [BR:ncs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     NCAS_0G03900 (NCAS0G03900)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-GeneID: 11528526
NCBI-ProteinID: XP_003677629
UniProt: G0VHH1
LinkDB All DBs
Position
7:complement(721778..723490)
Genome map
AA seq 570 aa AA seqDB search
MPSTLTLLSVFLLGTLSTTYFNPFNYLSQDLQDLQPSLQNITIHDFHAGTGDHRKIKINL
RPASPYSIPHENFTQWCHAQASIALDKILQNIANDNINDLSQRYNVSQGAVIASPSRSKP
NYFYQWTRDAALVMNPLILNLFSSDEKVNGTIASTLLKYLNNSYALQQLDNPSGNGTKYQ
DLKGLGEPKWEVNSTPFMEHWGRPQNDGPALRALTSFHLLKQLRQHNMTFEDLLNQIEDG
QLPFQNEQELFDKFIYYDLKFVMLYWKQDGFDLWEEVNGIHFFTALVQLKALDEALYFLS
LHTETTVEQPSLVQSLQRTFDDLLQFMLTQGNFIDPNKNHIVETPNFHERSGLDIAVILA
SLYSHNTDNNSTLPFDVTDSGVLNTLYGLMRSMGMIYPINHQRANLKIGVALGRYPEDIY
DGIGLSEGNPWFLATSSAAELLYKLIWNLQSNRKDLIIPLNDFNSQFWTIVFDGIAHEEL
QLHQSHPHDDIQLILPYDSPAFKQTLKLIFDLGESFLDKLREHVSKTGDMSEQFNKYTGF
LQGATHLTWSYSSFWNCYHLRNKLIELMKY
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgccctccacgctcactctcctctcggtattcctgctcggaacactctccaccacttac
ttcaacccgttcaactacctctcgcaggatctacaagatctacaaccctccctgcaaaac
ataaccatccacgacttccacgccggcaccggagaccacagaaagataaagatcaacctg
agaccggcctccccctactccatcccgcatgaaaacttcacgcaatggtgtcacgcccag
gcatccatcgccctggacaaaatactgcaaaacatcgcaaacgacaacattaacgatcta
tcgcaacgctataacgtgtcacagggcgccgtcatcgcgtcgccctcgcgctctaagcca
aattatttctatcaatggaccagggatgccgcgttggtcatgaacccattgatactcaac
ttgttctcgagcgatgagaaggttaatggcaccatcgcgtccactctcttgaaatacttg
aataattcgtacgctttgcaacaattggataatccttcagggaacggcaccaagtatcag
gatttgaaagggttgggcgaacccaaatgggaagtcaatagtaccccgtttatggaacat
tggggcagaccacagaatgatggacctgcgttaagagcattgaccagtttccatttattg
aaacaattgcgtcaacataatatgacgttcgaggatttgttaaaccagattgaagacggg
caattgcccttccaaaacgaacaagaactgtttgataaatttatttattacgatttgaaa
tttgtcatgttgtattggaaacaagacgggtttgacctttgggaagaggttaatggtatc
catttctttaccgctttggttcaattgaaggcattagatgaagctttgtacttcttgtcc
ttgcacacggaaacaacagtggaacaacccagtttagttcaatcattacaaaggacattc
gatgatttgttacaatttatgctcactcaggggaactttatagacccaaataaaaatcat
atagtggaaactccaaatttccatgaaagatcaggattagatatcgcagttatacttgca
tccctgtattctcataatacagacaataattccacactgcccttcgatgtcacagattca
ggtgtattgaacactttgtatggattaatgagatccatgggcatgatttatccgattaac
caccaaagagcaaatttgaaaattggtgttgccctaggacgctacccagaagatatttat
gatggaattggtctctcagagggtaatccatggttcttggccacctcatctgcagctgaa
ttattatataaattaatttggaatttacaatcaaatcgtaaagatttaattataccattg
aatgattttaattcacaattttggacaatcgtattcgatggtatagcacatgaagaatta
caattacatcaatcacacccacatgatgacattcaactaattttaccctatgattcaccc
gcctttaaacaaactttaaaactaatctttgacctcggtgaatcattcttggataaatta
agagaacatgtaagcaagaccggtgacatgagtgaacaatttaataaatacacagggttc
ttacaaggtgcaacacatttaacttggtcatatagttcattttggaattgttaccattta
agaaataaattaatcgaattgatgaaatattaa

DBGET integrated database retrieval system