KEGG   Candidatus Nitrosomarinus catalina: NMSP_0393Help
Entry
NMSP_0393         CDS       T04846                                 

Gene name
lysX_1
Definition
(GenBank) Alpha-aminoadipate--LysW ligase LysX
  KO
K05827  [lysine-biosynthesis-protein LysW]---L-2-aminoadipate ligase [EC:6.3.2.43]
Organism
nct  Candidatus Nitrosomarinus catalina
Pathway
nct00300  Lysine biosynthesis
nct01100  Metabolic pathways
nct01210  2-Oxocarboxylic acid metabolism
nct01230  Biosynthesis of amino acids
Module
nct_M00031  Lysine biosynthesis, mediated by LysW, 2-aminoadipate => lysine
Brite
KEGG Orthology (KO) [BR:nct00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    NMSP_0393 (lysX_1)
Enzymes [BR:nct01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.43  [lysine-biosynthesis-protein LysW]---L-2-aminoadipate ligase
     NMSP_0393 (lysX_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RimK ATP-grasp_3 GSH-S_ATP ATPgrasp_ST ATP-grasp CPSase_L_D2 ATP-grasp_5 Rimk_N
Motif
Other DBs
NCBI-ProteinID: ARS64016
UniProt: A0A2Z2HMH9
LinkDB All DBs
Position
complement(335094..335936)
Genome map
AA seq 280 aa AA seqDB search
MNPDVTILYDSIRWEEKALLEAGKKKDINIQMVDCKKLALDLEKKPEDYGVVIQRCVSYY
RNLHSTAALEGMGVKVINCLNTGVFAGNKLFTHMLLKKSGVPTPDATVAFSKDAAIQALE
TDGYPKVIKPTVGSWGRLISKLNDKDSAEGIIESRETMYPIYQIHYLEEFVKRPPRDIRA
IMVGDKIVAAIYRKSEHWKTNMALGGIAEPCKVTQEMEEMCIKAKQAVQGDIVGVDLMES
EEKGLVVHEVNNTTEYKNTVRVCDVDIPSLMLDYAMKVER
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcctgatgttacaattctttacgattccatacgttgggaagaaaaagctctacta
gaagcaggtaaaaaaaaggacatcaacatacagatggttgattgtaaaaaacttgcttta
gatttagaaaaaaaacccgaagattacggagtagttattcaacgatgtgtgagttattac
agaaatttacattcaacagcagctcttgaaggaatgggagttaaagtaatcaattgttta
aacacaggagtttttgcaggaaataaattattcacacatatgttactaaaaaaatcaggt
gttccaacaccagatgcaacagtggcattttcaaaggatgcagctattcaagcattagaa
acagatggatatccaaaagttataaaaccaacagtcggtagttggggcaggttaatttca
aaactaaatgacaaagattcagcagaaggaattattgaaagtagagaaactatgtatcca
atttaccaaattcattatttagaagaatttgtaaaaagacctccaagagatatcagagct
attatggtaggagacaaaatagttgctgcaatatatagaaaatcagaacattggaaaaca
aacatggcattaggtggaattgctgaaccatgcaaagttacacaagaaatggaagaaatg
tgtatcaaagcaaaacaagctgtacaaggagatattgtaggtgtagatttaatggaaagt
gaagaaaaagggttagtggttcatgaagttaacaatacaacagaatacaaaaacactgta
agagtatgtgacgtagacataccttctctaatgctggattacgcaatgaaagtagaacga
taa

DBGET integrated database retrieval system