KEGG   Neptunomonas concharum: F0U83_08020Help
Entry
F0U83_08020       CDS       T06194                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ncu  Neptunomonas concharum
Brite
KEGG Orthology (KO) [BR:ncu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    F0U83_08020 (ahpF)
Enzymes [BR:ncu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     F0U83_08020 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 FAD_oxidored DAO HI0933_like FAD_binding_3 Glutaredoxin Thi4 AlaDh_PNT_C Lycopene_cycl NAD_binding_8 K_oxygenase FMO-like Thioredoxin_4 NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: QEQ96665
UniProt: A0A5P1RBL0
LinkDB All DBs
Position
1714068..1715642
Genome map
AA seq 524 aa AA seqDB search
MLDANIKQQLDTYLRNIVNPIEIAVSVNTSDKSKELLSLAQEIAELSDKITLSVDDNPKD
RAPLMSIGALGSAPRVAFAGIPMGHEFTSLVLALLQAGGHPSKAEQALQDQAKSLTETLH
FETYISLSCQNCPDVVQALNLMAALNPNIQHTMIDGALFQDEVDARNIMAVPSVYLNGEL
FGQGRMTLAEILNKVDTGASQKQAEALSAKDPYDVLIVGGGPAGASAAIYAARKGIRTGI
VADRFGGQVMDTLSIENFISVKETEGPKLVANLEQHVLSYDVDLMNSQKATKLSVDNGVE
VTLENGAVLKSRSVILATGARWREMNVPGEQVYRGKGVAYCPHCDGPLFKGKKVAVIGGG
NSGIEAAIDLAGIVEHVTVLEFAETLRADEVLQRKARSMGNIEIITQAMTTEVIGDGQRV
TGLHYTDRATNESHLLSVAGIFVQIGLIPNTDWLKGDIELSQHGEIVIDSRGQTSLPGVF
AAGDVTTVPYKQIIIAMGAGSTAALSAFDHLIRTPVSASETQAA
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcaaatattaaacagcaattggacacctatcttcgaaatatcgtgaatccg
atcgaaattgctgtgtcagtgaataccagtgataaatcaaaagaattactgtcgttagcg
caagagatcgcggaattatccgataaaatcaccctcagcgttgatgacaacccaaaagac
cgtgcgcccttaatgtcgataggtgcgctaggctctgccccccgagtagcgtttgccggt
attccgatggggcatgaatttacctctttggtgttggctttattgcaggccggtggccat
ccctccaaagcggagcaggcattacaagaccaagcaaaaagtcttaccgagacattacat
tttgagacctatatctcactaagctgccaaaactgccctgatgtggtgcaagcgcttaac
ctaatggctgcactaaaccccaacatccaacacaccatgattgatggggcactgttccaa
gatgaggtagatgcccgcaatattatggcggtgccttcagtttacttaaatggtgaactg
tttggccaaggccgtatgaccttggcagagatactcaacaaagttgataccggcgctagc
cagaaacaggcagaagcgctatcggcaaaagacccttacgacgtcttgatcgtaggtggt
gggcctgcgggggcatcggcggctatctatgctgcacgaaaaggtatccgtaccggcatc
gttgccgatcgttttggcggacaggtgatggatacgctatcgattgagaacttcatctcc
gtcaaagagaccgaaggccccaaactggtagcgaacctagaacagcacgtcttaagttat
gatgtagacctgatgaacagccaaaaagccacaaagttatcggttgataatggggtggag
gtcacactggaaaacggcgctgtgcttaaaagccgctcagtaattttggcaaccggtgcc
cgctggcgtgagatgaatgtccccggtgagcaggtgtatcgcggcaaaggcgtagcttac
tgcccacactgtgacggccccttgtttaagggtaaaaaggtcgctgtgattggtggtggt
aactcgggtatcgaggcggcaatagaccttgccggtattgttgagcatgtcactgtttta
gagttcgcagaaaccttgcgagctgatgaagtgctgcaacgcaaagcgcgatccatgggt
aatattgagatcatcacgcaagcgatgaccaccgaagttatcggtgatgggcagcgggta
acagggcttcattacaccgaccgagccaccaatgagtcccacctgctatccgtggccggt
atctttgtgcagattggcttaatccctaacaccgattggctcaaaggagacattgaacta
agccagcatggtgagattgtgattgatagccgagggcaaacatccttgccgggtgtattt
gctgccggtgatgttacaaccgtaccctacaagcagattattatcgcaatgggagcaggc
tccacagcggcattaagtgcctttgatcacttgatccgcacaccggttagcgcatcagaa
acacaagcggcctaa

DBGET integrated database retrieval system